KEGG   Pongo abelii (Sumatran orangutan): 100461354Help
Entry
100461354         CDS       T01416                                 

Definition
(RefSeq) steroid 21-hydroxylase isoform X1
  KO
K00513  steroid 21-monooxygenase [EC:1.14.14.16]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00140  Steroid hormone biosynthesis
pon01100  Metabolic pathways
pon04925  Aldosterone synthesis and secretion
pon04927  Cortisol synthesis and secretion
pon04934  Cushing's syndrome
Module
pon_M00109  C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100461354
 Organismal Systems
  Endocrine system
   04925 Aldosterone synthesis and secretion
    100461354
   04927 Cortisol synthesis and secretion
    100461354
 Human Diseases
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    100461354
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.16  steroid 21-monooxygenase
     100461354
Cytochrome P450 [BR:pon00199]
 Cytochrome P450, animal type
  CYP21 family
   100461354
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 100461354
NCBI-ProteinID: XP_002816719
Position
6
AA seq 496 aa AA seqDB search
MLLLGLLLLLPLLAGARLLWNWWKLRSLHLPPLAPGFLHLLQPDLPIYLLVLTQKFGPIY
RLHLGLQDVVVLNSKRTIEEAMVKKWADFAGRPEPLTYKLVSKNYPDLSLGDYSLLWKAH
KKLTRSALLLGIRDSMEPVVEQLTQEFCERMRAQAGTPVAIEEEFSLLTCSIICYLTFGD
KIKEDNLMPAYYKCIQEVLKTWSHWSIQIVDVIPFLRFFPNPGLRRLKQAIERRDHIVEK
QLRQHKESLVAGQWRDMMDYMLQGVAQPSVEEGSGQLLEGHVHMAAVDLLIGGTETTANT
LSWAVVFLLHHPEIQQRLQEELDHELGPGASSSQVPYKDRARLPLLNATIAEVLRLRPVV
PLALPHRTTRPSSISGYDIPEGTVIIPKLQGAHLDETVWERPHEFWPDRFLEPGKSSTAL
AFGCRARVCLGEPLAHLELFLVLTRLLQAFTLLPPGDALPSLQPLPPTCSVILKMQPFQV
RLQPRGMGAHSPGQSQ
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgctgctcctgggcctgctgctgctgctgcccctgctggctggcgcccgcctgctgtgg
aactggtggaagctccggagcctccacctcccgcctcttgccccgggcttcttgcacctg
ctgcagcccgacctccccatctatctgctcgtcttgactcagaaattcgggcccatctac
aggctccaccttgggcttcaagatgtggtggtgctgaactccaaaaggaccattgaggaa
gccatggtcaaaaagtgggcagactttgctggcagacctgagccacttacctacaagctg
gtgtctaagaactacccagacctgtccttgggagactactccctgctctggaaagcccac
aagaagctcacccgctcagccctgctgctgggcatccgtgactccatggagccagtggtg
gagcagctgacccaggagttctgcgagcgcatgagagcccaggccggcacccctgtggcc
attgaggaggaattctctctcctcacctgtagcatcatctgttacctcaccttcggagac
aagatcaaggaggacaacttaatgcctgcctattacaaatgtatccaggaggtgttaaaa
acctggagccactggtccatccaaattgtggatgtgattccctttctcaggttcttcccc
aatccaggtctccggaggctgaagcaggccatagagaggagggaccacatcgtggagaag
cagctgaggcagcacaaggagagcctggtggcaggccagtggagggacatgatggactac
atgctccaaggggtggcgcagccgagcgtggaagagggctctggacagctcctggaaggg
cacgtgcacatggctgcagtggacctcctgatcggtggcactgagaccacggcaaacacc
ctctcctgggccgtggtttttttgcttcaccaccctgagattcagcagcgactgcaggag
gagctagaccacgaactgggccctggtgcctccagctcccaggtcccctacaaggaccgt
gcacggctgcccttgctcaatgccaccatcgccgaggtgctgcgcctgcggcccgttgtg
cccttagccttgccccaccgcaccacacggcccagcagcatctccggctacgacatccct
gagggcacagtcatcatcccgaaacttcagggcgcccacctggatgagacggtctgggag
aggccacatgagttctggcctgatcgcttcctggagccaggcaagagctccacagctctg
gccttcggctgcagggcccgtgtgtgcctgggcgagccgctggcgcatctggagctcttc
ctggtgctgacccgactgctgcaggccttcacgctgctgccccccggggacgccctgccc
tccctgcagcccctgccccccacctgcagtgtcatcctcaagatgcagcctttccaagtg
cggctgcagccccgggggatgggggcccacagcccgggccagagccagtga

DBGET integrated database retrieval system