KEGG   Pongo abelii (Sumatran orangutan): 100461407
Entry
100461407         CDS       T01416                                 

Gene name
ASIC1
Definition
(RefSeq) acid-sensing ion channel 1 isoform X1
  KO
K04829  acid-sensing ion channel 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:pon00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100461407 (ASIC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pon04040]
    100461407 (ASIC1)
Ion channels [BR:pon04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   100461407 (ASIC1)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 100461407
NCBI-ProteinID: XP_024113293
Ensembl: ENSPPYG00000004504
Position
12
AA seq 562 aa
MPIQIFCSVSFSSGEEAPGPLGDIWGPHHHQQQQDISESEEEEEEKEKEAVRKETSEGHS
PMDLVAFANSCTLHGTNHIFVEGGPGPRQVLWAVAFVLALGAFLCQVGDRVAYYLSYPHV
TLLNEVATTELAFPAVTLCNTNAVRLSQLSYPDLLYLAPMLGLDESDDPGVPLAPPGPEA
FSGEPFNLHRFYNRSCHRLEDMLLYCSYQGGPCGPHNFSVVFTRYGKCYTFNSGRDGRPR
LKTMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPFIDQLGFGVA
PGFQTFVACQEQRLIYLPPPWGTCKAVTMDSDLDFFDSYSITACRIDCETRYLVENCNCR
MVHMPGDAPYCTPEQYKECADPALDFLVEKDQEYCVCEMPCNLTRYGKELSMVKIPSKAS
AKYLAKKFNKSEQYIGENILVLDIFFEVLNYETIEQKKAYEIAGLLGDIGGQMGLFIGAS
ILTVLELFDYAYEVIKHKLCRRGKCQKEAKRSSADKGVALSLDDVKRHNPCESLRGHPAG
MTYAANILPHHPARGTFEDFTC
NT seq 1689 nt   +upstreamnt  +downstreamnt
atgcccatccagatcttctgctccgtgtcattctcctctggagaggaggccccagggccc
ttgggagatatttggggtccccaccaccatcagcagcagcaggacatctcagaatcggaa
gaggaggaagaagagaaggaaaaggaggcagtgaggaaggagaccagtgaggggcattca
cccatggacttggtggcctttgccaacagctgtaccctccacggcaccaaccacattttt
gtggaggggggtccagggccaaggcaggtgctgtgggcggtggcctttgtcctggcactg
ggtgccttcctgtgccaggtaggggaccgcgttgcttattacctcagctacccacacgtg
acccttctaaacgaagtggccaccacggagctggccttcccggcagtcaccctctgcaac
actaatgccgtgcggctgtcccagctcagctaccctgacttgctttatctggcccccatg
ctgggactggatgaaagtgatgaccccggggtgccccttgctccaccgggccctgaggcc
ttctctggggagccctttaacctgcaccgcttctacaatcgctcctgccaccggctggag
gacatgctgctctattgctcctaccaagggggaccctgcggccctcacaacttctcagtg
gtcttcacacgctatggaaagtgctacacgttcaactcgggccgagatgggcggccgcgg
ctgaagaccatgaagggtgggacgggcaatgggctggaaatcatgctggacatccagcag
gacgagtacctgcctgtgtggggggagactgacgagacgtccttcgaagcaggcatcaaa
gtgcagatccatagtcaggatgaacctcctttcatcgaccagctgggctttggcgtggcc
ccaggcttccagacctttgtggcctgccaggagcagcggctcatctacctgcccccgccc
tggggcacctgcaaagctgttaccatggactcggatttggatttcttcgactcctacagc
atcactgcctgccgcatcgactgtgagacgcgctacctggtggagaactgcaactgccgc
atggtgcacatgccaggggatgccccatactgtacaccagagcagtacaaggagtgtgca
gatcctgctctggacttcctggtggagaaggaccaggagtactgcgtgtgtgaaatgcct
tgcaacctgacccgctatggcaaggagctgtccatggtcaagatccccagcaaagcctca
gccaagtacctggccaagaagttcaacaaatctgagcaatacataggggagaacatcctg
gtgctggacattttctttgaagtcctcaactatgagaccattgaacagaagaaggcctat
gagattgcagggctcctgggtgacatcgggggccagatggggctgttcatcggggccagc
atcctcacggtgctggagctctttgactacgcctacgaggtcattaagcacaagctgtgc
cgacgaggaaaatgccagaaggaggccaaaaggagcagtgcggacaagggcgtggccctc
agcctggacgacgtcaaaagacacaacccgtgcgagagcctccggggccaccctgccggg
atgacatacgctgccaacatcctacctcaccatccggcccgaggcacgttcgaggacttt
acctgctga

DBGET integrated database retrieval system