KEGG   Pongo abelii (Sumatran orangutan): 100461936
Entry
100461936         CDS       T01416                                 

Definition
(RefSeq) AF4/FMR2 family member 3-like
  KO
K15195  AF4/FMR2 family member 3
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
KEGG Orthology (KO) [BR:pon00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:pon03021]
    100461936
Transcription machinery [BR:pon03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     100461936
SSDB
Motif
Pfam: AF-4
Other DBs
NCBI-GeneID: 100461936
NCBI-ProteinID: XP_024097453
Position
Unknown
AA seq 225 aa
MKDFLTDRSNQSHLVGVPKPGVPQTPVNKIDEHFVADSRAQTQPSSICSTTTSTPAAVPV
QQSKRGTMGWQKAGHPPSDGQQRATQQGSLRTLLGDGVGRQQPRAKQVCNVEVGLQTQER
PPAMAAKHSSSGHCVQNFPPSLASKPSLVQQKPTAYVRPMDGQDQAPDESPKLKSSSETS
VHCTSYRGVPASKPEPARAKAKLSKFSIPKQGEVSLYQHHSRATA
NT seq 678 nt   +upstreamnt  +downstreamnt
atgaaagactttttaactgatagatccaatcagagtcatctcgttggagttcccaaacct
ggggttcctcagactcctgtgaacaagatcgatgaacattttgttgcagattcaagagcc
cagacccagccctcatctatctgtagcactacaacttccacaccagcagctgtccccgtg
cagcagagtaagagaggcactatgggctggcagaaggctgggcacccaccctccgacggc
caacagagagcaacacagcagggctctctcaggaccttgcttggagatggtgttggcaga
cagcagccgcgggccaaacaagtgtgcaatgtggaggtgggccttcagacccaggagagg
ccacctgccatggcggccaagcacagcagcagcggacactgtgttcagaactttcctcca
tccctagcttcaaaacccagcctggtccagcagaaaccgaccgcgtacgtgcggccaatg
gacggccaagatcaggcccctgatgagtctcctaagctgaagtcgtcttcggaaactagc
gtgcactgcacatcatacaggggagtccctgccagcaagccggagcctgccagagccaag
gccaagctctccaagttcagcatccccaagcagggggaggtgagtctttatcagcaccat
tcacgtgcaactgcgtag

DBGET integrated database retrieval system