KEGG   Pongo abelii (Sumatran orangutan): 100462435Help
Entry
100462435         CDS       T01416                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase isoform X1
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00561  Glycerolipid metabolism
pon01100  Metabolic pathways
pon04714  Thermogenesis
pon04723  Retrograde endocannabinoid signaling
pon04923  Regulation of lipolysis in adipocytes
Module
pon_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    100462435 (MGLL)
 Organismal Systems
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    100462435 (MGLL)
  Nervous system
   04723 Retrograde endocannabinoid signaling
    100462435 (MGLL)
  Environmental adaptation
   04714 Thermogenesis
    100462435 (MGLL)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100462435 (MGLL)
Peptidases [BR:pon01002]
 Serine Peptidases
  Family S33
   100462435 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Esterase Lipase_3 PGAP1 Abhydrolase_5 DLH Peptidase_S9 Abhydrolase_3 Thioesterase Abhydrolase_2 DUF1057 LIDHydrolase BAAT_C DUF1350
Motif
Other DBs
NCBI-GeneID: 100462435
NCBI-ProteinID: XP_002813210
Ensembl: ENSPPYG00000013440
UniProt: H2P9F6
Position
3
AA seq 313 aa AA seqDB search
METGPEDPSRMPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHG
AGEHCGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHIFVRDVLQHVDSMQKD
YPGLPVFLLGHSMGGAVAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLV
LPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVP
FLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWV
SQRTATAGTASPP
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaggacctgaagacccttccagaatgccagaggaaagttcccccaggcggacc
ccacagagcattccctaccaggacctccctcacctggtcaatgcagatggacagtacctc
ttctgcaggtactggaaacccacaggcacacccaaggccctcatctttgtgtcccacgga
gccggagagcactgtggccgctatgaagagctggctcggatgctgatggggctggacctg
ctggtgtttgcccacgaccatgttggccacggacagagtgaaggggagaggatggtagtg
tctgacttccacattttcgtcagagatgtgttgcagcatgtggattccatgcagaaagac
taccctgggcttcctgtcttccttctgggccactccatgggaggcgccgtcgccatcctc
acggccgcagagaggccgggccacttcgccggcatggtactcatttcgcctctggttctt
gccaatcctgaatctgcaacaactttcaaggtccttgctgcaaaagttctcaaccttgtg
ctgccaaacttgtccctcgggcccatcgactccagcgtgctctctcggaataagacagag
gtcgacatttataactcagaccccctgatctgccgggcagggctgaaggtgtgcttcggc
atccagctgctgaatgccgtctcgcgggtggagcgcgccctccccaagctgactgtgccc
ttcctactgctccagggctctgccgatcgcctgtgtgacagcaaaggggcctacctgctc
atggagttagccaagagccaggacaagactctcaagatttatgaaggtgcctaccatgtt
ctccacaaggagcttcctgaagtcaccaactctgtcttccatgaaataaacatgtgggtc
tctcaaaggacagccacggcaggaactgcatccccaccctga

DBGET integrated database retrieval system