KEGG   Pongo abelii (Sumatran orangutan): 100938272Help
Entry
100938272         CDS       T01416                                 

Definition
(RefSeq) histone H2B type 2-F isoform X1
  KO
K11252  histone H2B
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon05034  Alcoholism
pon05203  Viral carcinogenesis
pon05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:pon00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100938272
  Immune diseases
   05322 Systemic lupus erythematosus
    100938272
  Substance dependence
   05034 Alcoholism
    100938272
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    100938272
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100938272
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Motif
Other DBs
NCBI-GeneID: 100938272
NCBI-ProteinID: XP_003780285
UniProt: A0A2J8VEH1
Position
1
AA seq 134 aa AA seqDB search
MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSKLIGPILWK
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgccggatccagcaaaatccgctcctgctcccaagaagggctccaaaaaggctgttacg
aaagtgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactccgtt
tacgtgtacaaggtgctgaagcaggtccaccccgacaccggcatctcgtccaaggccatg
ggcatcatgaactccttcgtcaacgacatcttcgagcgcatcgctggagaggcgtcccgc
ctggcacactacaacaagcgctccaccatcacatcccgcgagatccagacggccgtgcgc
ctgctgctgcccggtgagctggccaagcacgccgtgtccgagggcaccaaggcggtcact
aagtacaccagctcgaagttaataggacccatcctttggaagtag

DBGET integrated database retrieval system