KEGG   Pongo abelii (Sumatran orangutan): 103890872Help
Entry
103890872         CDS       T01416                                 

Definition
(RefSeq) heat shock 70 kDa protein 1
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon03040  Spliceosome
pon04010  MAPK signaling pathway
pon04141  Protein processing in endoplasmic reticulum
pon04144  Endocytosis
pon04213  Longevity regulating pathway - multiple species
pon04612  Antigen processing and presentation
pon04915  Estrogen signaling pathway
pon05134  Legionellosis
pon05145  Toxoplasmosis
pon05162  Measles
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    103890872
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103890872
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103890872
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103890872
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    103890872
  09152 Endocrine system
   04915 Estrogen signaling pathway
    103890872
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    103890872
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    103890872
  09172 Infectious disease: viral
   05162 Measles
    103890872
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103890872
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    103890872
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pon03041]
    103890872
   03009 Ribosome biogenesis [BR:pon03009]
    103890872
   03110 Chaperones and folding catalysts [BR:pon03110]
    103890872
   04131 Membrane trafficking [BR:pon04131]
    103890872
   03051 Proteasome [BR:pon03051]
    103890872
   03029 Mitochondrial biogenesis [BR:pon03029]
    103890872
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    103890872
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     103890872
Spliceosome [BR:pon03041]
 Complex B
  Other components
   Prp19 complex
    103890872
 Complex C
   Prp19-CDC5 complex
    103890872
Ribosome biogenesis [BR:pon03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    103890872
Chaperones and folding catalysts [BR:pon03110]
 Heat shock proteins
  HSP70 / DNAK
   103890872
Membrane trafficking [BR:pon04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    103890872
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    103890872
Proteasome [BR:pon03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    103890872
Mitochondrial biogenesis [BR:pon03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    103890872
Exosome [BR:pon04147]
 Exosomal proteins
  Proteins found in most exosomes
   103890872
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Radial_spoke_3
Motif
Other DBs
NCBI-GeneID: 103890872
NCBI-ProteinID: XP_024104850
Position
6
AA seq 641 aa AA seqDB search
MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
LNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEIS
SMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAA
IAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNH
FVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRA
RFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLN
KSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTI
PTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDI
DANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKN
ALESYAFNMKSAVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELE
QVCNPIISGLYQGAGGPGPGGFGAQGPKGGSGSGPTIEEVD
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagccgcggcgatcggcatcgacctgggcaccacctactcctgcgtgggggtg
ttccagcacggcaaggtggagatcatcgccaacgaccagggcaaccgcaccacccccagc
tacgtggccttcacggacaccgagcggctcatcggggatgcggccaagaaccaggtggcg
ctgaacccgcagaacaccgtgtttgacgcgaagcggctgatcggccgcaagttcggcgac
ccggtggtgcagtcggacatgaagcactggcctttccaggtgatcaacgacggagacaag
cccaaggtgcaggtgagctacaagggggagaccaaggcattctaccctgaggagatctcg
tccatggtgctgaccaagatgaaggagatcgccgaggcgtacctgggctacccggtgacc
aacgcggtgatcaccgtgccggcctacttcaacgactcgcagcgccaggccaccaaggat
gcgggtgtgatcgcggggctcaacgtgctgcggatcatcaacgagcccacggccgccgcc
atcgcctacggcctagacagaacgggcaagggggagcgcaacgtgctcatctttgacctg
ggcgggggcaccttcgacgtgtccatcctgacgatcgacgacggcatcttcgaggtgaag
gccacggccggggacacccacctgggtggggaggactttgacaacaggctggtgaaccac
ttcgtggaggagttcaagagaaaacacaagaaggacatcagccagaacaagcgagccgtg
aggcggctgcgcaccgcctgcgagagggccaagaggaccctgtcgtccagcacccaggcc
agcctggagatcgactccctgtttgagggcatcgacttctacacgtccatcaccagggcg
aggttcgaggagctgtgctcggacctgttccgaagcaccctggagcccgtggagaaggct
ctgcgcgacgccaagctggacaaggcccagatccacgacctggtcctggtcgggggctcc
acccgcatccccaaggtgcagaagctgctgcaggacttcttcaacgggcgcgacctgaac
aagagcatcaaccccgacgaggctgtggcctacggggcggcggtgcaggcggccatcctg
atgggggacaagtccgagaacgtgcaggacctgctgctgctggatgtggctcccctgtcg
ctggggctggagacggccggaggcgtgatgactgccctgatcaagcgcaactccaccatc
cccaccaagcagacgcagatcttcaccacctactccgacaaccaacccggggtgctgatc
caggtgtacgagggcgagagggccatgacgaaggacaacaatctgttggggcgcttcgag
ctgagcggcatccctccggcccccaggggcgtgcctcagatcgaggtgaccttcgacatc
gatgccaacggcatcctgaacgtcacggccacggacaagagcaccggcaaggccaacaag
atcaccatcaccaacgacaagggccgcctgagcaaggaggagatcgagcgcatggtgcag
gaggcggagaagtacaaagcggaggacgaggtgcagcgcgagagggtgtcagccaagaac
gccctggagtcctacgccttcaacatgaagagcgccgtggaggatgaagggctcaagggc
aagatcagcgaggccgacaagaagaaggtgctggacaagtgtcaagaggtcatctcgtgg
ctggacgccaacaccctggccgagaaggacgagtttgagcacaagaggaaggagctggag
caggtgtgtaaccctatcatcagcggactgtaccagggtgcgggtggtcccgggcctggc
ggcttcggggctcagggtcccaagggagggtctgggtcaggccccaccattgaggaggtg
gattag

DBGET integrated database retrieval system