KEGG   Populus trichocarpa (black cottonwood): 18097145Help
Entry
18097145          CDS       T01077                                 

Definition
(RefSeq) wall-associated receptor kinase-like 17
Organism
pop  Populus trichocarpa (black cottonwood)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr GUB_WAK_bind WAK PIP49_C
Motif
Other DBs
NCBI-GeneID: 18097145
NCBI-ProteinID: XP_024448433
Position
Unknown
AA seq 693 aa AA seqDB search
MQVVKLVSHVSFLLLMLMFQPATAQAPAGLAKPNCSDRCGNISIPYPFGIGKDCYMEESF
DVECNETSKPPRAFLRSIKMELVNITLEGGAVVNGPVISVDSSGRQEGVTVNLEGTPFLF
SYTNYFIAVGCNTRAALWTKKGTDEHVGCDSICSNASSISNIRFGNSSCSGKDCCQDMYL
PPSLQVFNSTVVSKEGKQGSDGRKLAFLADTNWFYNNIRTPQEINKLLNNNSTVPMSLAW
ILNNNSWTYNQDTTTYCSGTQINSTSTIMTAGCSCSEGYEGNPYLQCRALYMWEFKTENL
SDVFFAPNTVVGLVGVLFLLIGARWIYNCFQLKKKFFKRNGGLLLQQQLSSSDGSVQKTK
IFSSNELEKATDYFNESRILGHGGQGTVYKGMLAAGTIVAVKKSKIVDEDKLEEFINEVV
ILSQISHRNVVRLLGCCLETDVPLLVYEFIPSGTLFQYLHEQNEDFTLSWELRLRIASEA
AGAISYLHSTASIPIYHRDIKSTNILLDEKYRAKVSDFGTSRSVSIDQTHLTTKVQGTFG
YLDPEYFRTSQLTEKSDVYSFGVVLVELLSGKKPIFLTHSLETMSLAEHFIKLMEDSRLF
DIIDAQVKGDCSEEEAIVIANLAKRCLNLNGRNRPTMREVAMELEGILLSRNGINIQQIG
EVDNSSRSISRSSFESGIDLPLDCKPSTSSETW
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atgcaggttgtgaaacttgtctcccatgtttctttcttgttattaatgctgatgtttcag
ccagcaacagcgcaagcaccggctggtctggcaaaacctaattgttcggaccgctgtgga
aatattagcattccatacccgttcgggattggaaaggattgctacatggaggaatctttt
gacgttgaatgcaatgaaacttccaaacctcctagagcttttttacgcagcatcaaaatg
gagttggtgaatattacattagaaggaggtgcagttgtcaacggtccagtgatatccgtt
gattcttcgggccggcaagaaggtgtaactgtgaatttggaaggaactcctttcctcttt
tcctataccaattatttcattgcagtgggttgcaatactcgtgccgctctgtggacaaaa
aagggcacggacgaacatgttggatgcgactcaatttgctccaacgctagttccattagt
aatattcggtttggaaatagttcatgctctggtaaggactgttgtcaagatatgtacttg
cctccctcacttcaggttttcaattcaactgtcgtgtcaaaagagggtaaacaaggtagt
gacgggcgtaaactggccttcctagcagacacgaattggttttataacaatataaggact
ccccaagaaatcaacaaattgctaaataacaatagtactgttcctatgtcgctggcttgg
atactaaataacaatagttggacatacaaccaagatacaaccacgtattgctccggaacg
caaattaatagtacgtcgacaattatgacagccggttgttcttgctcagaaggttacgag
ggcaacccttaccttcaatgcagagctttgtacatgtgggaattcaagactgagaaccta
agcgatgttttttttgctcctaatacagttgtcggtctggttggagtactgttcctgctc
attggtgctcggtggatatacaattgctttcagttgaagaagaagtttttcaaacggaat
ggtggtctcttattgcagcagcaattatcctcaagtgatggtagtgttcaaaagacaaag
atatttagttcaaatgagttggaaaaggcgactgattattttaacgagagcagaatactt
ggtcatggcggccaaggcaccgtttacaagggaatgttagctgcagggactatcgttgca
gttaagaagtctaagatagtggatgaagataaactagaagaattcatcaacgaggttgtc
attctttcacaaatcagtcacagaaatgtggttaggctactcggatgttgcctggagact
gatgttcctctgctagtctatgaattcattcccagtggaactcttttccaatatctccat
gagcaaaacgaggactttacgttatcatgggagttgcggttacgaattgcctcggaagct
gcaggtgcgatatcctatcttcactcgacagcatctatcccgatttatcaccgagacatt
aagtccacaaacatactcttagatgagaaatatagagcaaaagtttcagatttcggaact
tcaagatcagtttccatcgatcaaactcatctgaccaccaaggtgcaaggtacttttggt
tacttagatccagagtattttcgaaccagtcaattaacagaaaagagtgatgtttatagt
tttggagtagttctcgtcgagctcttaagtgggaaaaaacctattttcttaacccattca
ctggaaaccatgagcttagccgaacatttcattaaattgatggaagatagtagactcttt
gatatcattgatgctcaagttaagggggattgcagtgaagaggaagccatagttatagca
aatcttgcaaagagatgtttgaatttgaatggaagaaacagaccaacaatgagagaagtt
gcaatggaattggaggggattctattatcacgtaacggtatcaatattcaacaaattggt
gaagtggataattcatcgaggtcgatttcccgcagcagtttcgagagtggtatagatcta
ccattagattgcaaaccgtcgacttcttctgaaacatggtga

DBGET integrated database retrieval system