KEGG   Populus trichocarpa (black cottonwood): 18097409Help
Entry
18097409          CDS       T01077                                 

Definition
(RefSeq) cysteine-rich receptor-like protein kinase 15
Organism
pop  Populus trichocarpa (black cottonwood)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Stress-antifung DUF3403 Haspin_kinase APH Pkinase_fungal ABC1
Motif
Other DBs
NCBI-GeneID: 18097409
NCBI-ProteinID: XP_006383949
Position
4
AA seq 663 aa AA seqDB search
MILMTTIDVNLVMFLLIILFSALPAITVADHLVTSCFDNTSNYTLNSPFESNLKLLLENL
PSITSLTGFNHTSVGDFPAKVYGQALCRGDVNSSSCQACVEKASQEIFNDCRNYKDAIIW
YELCKVHYSFQNMTSLYVYTGKYPDWDSQEKFLSDPKHFSDVLIYLMTNLSTEAAVNPSK
HMFATGSIKFRSETVYGHAQCTRDIVADDCQTCLTTALAELKGCCSSRQGGIILSRNCDV
RFELYKYYNASSYSLTYPNPKGSNWKIGIVAFAACAPVVVIVIVIGSCIVCLLKKRGQQR
GVERSHLALLQELACPRGVTMTDEGQLVSSEDLPFMDLTTIREATDNFSDSNKLGQGGFG
TVYKGVLPDGKEIAVKRLSRKSWQGLEEFKNEVKVIAKLQHRNLVRLLGCGIEGDEKLLI
YEFMHNKSLDIFIFDAERRALLDWETCYNIAGGIARGLLYLHEDSRLRIIHRDLKPSNVL
LDHEMVAKISDFGMARIFCENQNKANTRRVVGTFGYMAPEYAMGGLFSVKSDVFSFGVIL
LEITSGKRSSGFYLSEHGQTLLAYAWRLWNEGREMELVDPSLMDRSQTEGIVRCIHVGLL
CVQEDPADRPTMSFVVLALGSDPIALPQPKQPAFTLGKMVPIYKSSPTDPSVNQMTVSGI
TPR
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgatcctgatgacaaccatagatgtaaatttagtcatgtttttgctgatcatactgttt
tcagctctcccagccattactgttgcagaccatcttgttacatcttgcttcgataataca
agcaactacactctcaacagtccatttgagagcaacctcaagcttcttcttgagaacttg
ccttccatcacttcattaacaggttttaaccacacctctgttggagatttccctgccaag
gtctatggccaagcactgtgcagaggtgatgtcaactcaagttcttgtcaggcttgtgtg
gagaaggcaagccaagaaatctttaatgattgtagaaattataaagatgcaatcatatgg
tatgaactttgcaaagttcactactcgtttcagaatatgacttccttgtatgtttataca
gggaagtatccagactgggattctcaggagaaatttctatcagatccaaaacatttctct
gatgttctaatctacttaatgactaacctgtcaactgaggccgctgtcaatccttccaag
cacatgtttgcaactgggtcaatcaaatttagaagcgaaaccgtatatggtcatgcacag
tgcacacgagatatcgtagcagatgattgtcaaacatgtttgacaactgctttggctgaa
ctcaaaggatgctgttcgtcacggcaaggtggaattattcttagcaggaattgcgacgtg
agatttgagctgtacaaatattacaatgcctcgagttactcgttaacatatccgaatcct
aaaggaagtaattggaagattgggatagtggcatttgctgcatgtgctcctgtagtggtg
attgtaattgtcattgggtcttgcattgtctgtctgctgaaaaaaagaggacaacaaaga
ggcgtggaaagaagtcacctagcattattacaggaattggcctgtccaagaggggtcaca
atgacagatgaaggtcagttggtaagttctgaggacctgcctttcatggacttaactact
atcagagaagctacagacaacttctccgattcaaataagcttggacaaggtgggtttggc
actgtttataagggtgtgttaccagatgggaaagaaatagctgttaagaggctgtcaagg
aagtcatggcaaggcttagaggagttcaagaatgaagtcaaagtaattgcaaaattacag
caccgaaaccttgtgaggctattgggatgtggcatagaaggagatgaaaagctgctcata
tatgaattcatgcataacaaaagccttgatatctttatctttgatgccgaaagacgcgca
cttcttgattgggagacatgttacaacatagctggtgggattgctagaggacttctttat
ctacacgaggattcccggcttagaatcattcaccgggatttgaaacctagcaatgtgcta
ctagaccatgaaatggttgccaagatatcagattttggcatggctagaattttctgcgaa
aaccagaacaaagctaatactagaagagtagtaggaacattcggatatatggctccggag
tacgcaatgggagggctattctcagtgaaatcagatgtcttcagctttggtgtcatacta
ctggagatcacaagtggaaaaagaagtagtggcttttatctctcagaacatggccagaca
ctcttagcatatgcgtggagattgtggaatgaagggagagaaatggaattagtggatcct
tcgttgatggacagaagtcaaacagaagggattgtgaggtgcatacatgttgggctgtta
tgtgtgcaggaagatccagcagacaggccaacaatgtcatttgtggttctagctttggga
agtgacccaatagctcttcctcagccgaaacaacctgctttcactctaggtaaaatggtt
ccaatctacaagtcttcaccgacagatccttctgtaaatcaaatgactgtttctggtatc
acaccgcgctga

DBGET integrated database retrieval system