KEGG   Populus trichocarpa (black cottonwood): 18099894Help
Entry
18099894          CDS       T01077                                 

Definition
(RefSeq) protein S-acyltransferase 24
  KO
K20032  palmitoyltransferase ZDHHC13/17 [EC:2.3.1.225]
Organism
pop  Populus trichocarpa (black cottonwood)
Brite
KEGG Orthology (KO) [BR:pop00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pop04131]
    18099894
Enzymes [BR:pop01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     18099894
Membrane trafficking [BR:pop04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    18099894
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC Ank_2 Ank_5 Ank_3 Ank_4 Ank DUF4153
Motif
Other DBs
NCBI-GeneID: 18099894
NCBI-ProteinID: XP_024459500
Position
6
AA seq 638 aa AA seqDB search
MPSEIEIVEEDVVAQSNDRESAAVNGGISNNGVAVAGEDSLRNDVYTAAAYGDLEKLQRL
VESEGCSVSVPDNLGYYALQWAALNNRTAAAQYIIEHGGDVNVVDHTGQTALHWTAVRGA
IQVAELLLQEGAGVNAADMYGYQTTHVAAQYGQTAFLYHIVSKWNADPDVPDFDGRSPLH
WAAYKGFADSIRLLLFLDSYRGRQDREGCTPLHWAAIRGNLEACTVLVQAGKKEDLMVTD
NTGLTPAQLASDKNHRQVAFFLGNARRLLDKQCDGNDRLGRLSKLGLAPVLWFIIILLLL
IYVNSVILASNLPKLTAGFGLLAWLAVFLATGGLVMFYRCSRKDPGYIRMNVHDPQNMKD
DEPLLKIEINNPALLAGNWSQLCATCKIVRPLRAKHCSTCDRCVEQFDHHCPWVSNCIGK
KNKWEFFAFLVLEVSAMLITGAVTLTRVLTDPFAPSSLGAWVNHAGSHHIGAISFLIMDF
FLFFGVAVLTVVQASQISRNITTNEMANALRYSYLRGPGGRFRNPYDHGCKKNCSDFLIN
GYNEDVDYNEDSPHSEGIGMMHMSRNSNLQNGDAHSHHMNGNGHVAINVNSENKIPQGHV
HSSHCSHNHQGKPRTDSAPLGLGGLGLGKSSARTVEAS
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgccatcagagattgagatagtagaggaagatgtggtggcccaatccaacgatcgagaa
tcagcagctgttaatggaggcattagtaataatggggttgctgttgctggagaagacagc
ttgagaaatgatgtttacacagcagctgcttatggagatttagagaagcttcagagattg
gttgagagtgaaggatgttctgtttctgtacctgataaccttggttattatgctttacag
tgggctgctttgaataatcgcacggctgctgctcagtatattatcgagcatggaggagat
gtaaatgtggttgatcatacaggccagacagcattgcattggactgcagtccggggtgca
attcaagttgctgagctgttgctacaagagggtgcgggggtaaatgccgccgatatgtat
ggctatcagacaactcatgttgcagctcaatatggtcagacagcttttctctatcacatt
gtctcaaaatggaatgctgaccccgatgttcctgactttgatggaagaagccctttacac
tgggctgcttataaaggttttgctgattctatacgccttctattgtttctggattcttat
agaggacgccaagatagagagggatgcactcctctccattgggctgctattaggggtaac
ttggaggcatgcacagtgctagtacaggctggaaagaaagaggacttgatggtgactgat
aacactggccttactccagcgcagcttgcttctgacaaaaatcatcgacaagttgctttt
ttcctaggaaatgctagaaggttgcttgacaaacaatgtgatgggaacgaccgcctggga
cgcctctcaaagttggggcttgcacctgtgttgtggttcataattatacttctcctgttg
atctatgttaattctgtcatcctggcttcaaatctgccaaagttaacagctggctttggc
cttcttgcctggcttgctgttttcctggctactggtggactagttatgttttatagatgt
agcaggaaggatccaggttacattagaatgaatgtgcatgatccacagaatatgaaagat
gatgagccacttttgaagattgagataaacaaccctgctttgctagctgggaattggtct
cagctctgtgcaacatgcaagattgtcagacctctccgtgcaaagcactgttccacatgt
gatcgatgtgttgaacaatttgatcatcattgcccttgggtatctaactgtattggcaag
aaaaacaaatgggaattctttgcatttcttgttctagaagtttcagcaatgttgataact
ggtgcagtgactctcacaagagttctgactgatccatttgctccgtcttcactgggagca
tgggtaaaccatgctggctctcatcatattggtgctatatcatttttgattatggacttc
ttcctcttctttggcgtggcagtattaactgttgtacaagcttctcagatatctcgcaat
ataacaaccaatgaaatggcaaatgcactgcggtatagctaccttaggggcccagggggc
cgcttcagaaacccatatgatcatggctgtaaaaagaattgctcagatttcttgatcaat
ggttacaatgaagatgtggattataatgaagattctccacattctgaggggattggaatg
atgcacatgtcgaggaattcaaacttgcaaaatggggatgctcattctcatcacatgaat
ggcaatggccatgtggctatcaatgtgaattcagaaaataaaatccctcagggtcatgtc
cattcttcccattgcagccataatcaccaagggaagccaagaacagatagcgcacccttg
ggtttgggtggtcttggtcttggaaaaagcagtgcccgaacagttgaagcttcatga

DBGET integrated database retrieval system