KEGG   Populus trichocarpa (black cottonwood): 18102341Help
Entry
18102341          CDS       T01077                                 

Definition
(RefSeq) probable serine/threonine-protein kinase PIX7
Organism
pop  Populus trichocarpa (black cottonwood)
Brite
Enzymes [BR:pop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     18102341
Protein kinases [BR:pop01001]
 Serine/threonine kinases: TKL group
  IRAK family
   18102341
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase
Motif
Other DBs
NCBI-GeneID: 18102341
NCBI-ProteinID: XP_024465122
Position
10
AA seq 479 aa AA seqDB search
MGLGSEEGKVKSSWDVCKSKERKKKKKDGTEAGCWVKLRFIGSCISSRSKVDSSVSGTST
HFESKSTNDTSIDQPAALVVSTSTTSNTESNSSTSKLEEELKVASRLRKFTFNDLKFATR
NFRPESLLGEGGFGCVFKGWIEENGTAPVKPGTGLTVAVKTLNHDGLQGHKEWLAEVNFL
GDLVHPNLVKLIGYCIEDDQRLLVYEFMPRGSLENHLFRRSLPLPWSIRMKIALGAAKGL
AFLHEETERPVIYRDFKTSNILLDADYNAKLSDFGLAKDGPEGDKTHVSTRVMGTYGYAA
PEYVMTGHLTSRSDVYSFGVVLLEMITGRRSMDKNRPNGEHNLVEWARPHLGERRRFYRL
IDPRLEGHFSIKGAQKAAQLAAHCLSRDPKARPLMSEVVNALKPLPNLKDMASTSYYFQT
MQAERVGSSPNARNGVRSQAGLLSRNGHQQRSLSIPHGSHASPYHYQYPHKSPKPNGKP
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgggattaggtagtgaagaaggtaaagtgaagtcttcttgggatgtgtgcaaatcaaag
gagaggaagaagaagaagaaagatggtacagaggcagggtgttgggtcaagttgaggttt
ataggaagctgcatttcttcaagatccaaagttgatagctctgttagtgggactagtacc
cattttgaaagtaaatccacgaatgatacaagcatagaccaaccagctgctcttgttgtt
tcaacctcaaccacaagtaatacagaaagtaactcatccacttccaaacttgaagaggag
cttaaagttgcttcccgactaaggaagttcacatttaatgatctcaagtttgcgacaaga
aattttagacctgagagtcttcttggtgaaggtggctttggttgtgttttcaagggatgg
attgaagaaaatggaactgctccagtgaaacctggtactggcctcactgttgctgttaaa
acccttaatcatgatgggctccaaggtcataaagagtggctggctgaagtgaatttcctt
ggcgatcttgttcatcctaacctggttaaattgattggctactgcattgaagatgatcaa
aggctgctagtgtacgagttcatgcctcgaggaagcttggagaaccacctgtttcgaagg
tccctgcctcttccatggtccataagaatgaaaattgctttaggtgctgccaaaggtctt
gcctttcttcatgaagaaactgaaaggccggtgatttatcgtgattttaagacctccaat
atcttattagatgcggattataatgccaagctttctgattttggacttgccaaagatggt
cctgagggagataagacccatgtatcaacccgtgtgatgggaacttatggttatgcggcc
ccagagtatgtaatgactggacatcttacttcaaggagtgacgtctacagttttggtgtg
gtcttgcttgaaatgataactggcagaagatcaatggataagaaccgacctaatggagaa
cataaccttgttgagtgggcgagaccacatctaggggagagaagaagattctaccggttg
atagaccctcggcttgaaggtcacttttcaataaaaggtgcccagaaagctgcacagcta
gctgctcattgccttagtagggatcctaaagccaggcctctaatgagtgaagtggtcaac
gcattgaagcctctgcccaacctcaaggacatggcaagcacatcatattatttccagacc
atgcaagctgaacgggttggatccagcccaaatgcgagaaatggtgtccgctcacaggct
ggattgttatctaggaacgggcaccaacaaaggagtctttcaataccacatggttcccat
gcttccccttatcactatcaatacccccataaatcgccaaaacccaatggtaaaccatag

DBGET integrated database retrieval system