KEGG   Populus trichocarpa (black cottonwood): 18102450Help
Entry
18102450          CDS       T01077                                 

Definition
(RefSeq) glutathione transferase GST 23
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
pop00480  Glutathione metabolism
pop01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pop00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    18102450
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pop02000]
    18102450
Enzymes [BR:pop01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     18102450
Transporters [BR:pop02000]
 Other transporters
  Pores ion channels [TC:1]
   18102450
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3 Glutaredoxin GST_C_6 GST_N_4
Motif
Other DBs
NCBI-GeneID: 18102450
NCBI-ProteinID: XP_006378305
Position
10
AA seq 222 aa AA seqDB search
MEDVKLHSFWPSPYCYRVIWALKLKGIRYEYVEEDLSNKSQALLQYNPIHKKVPVLVHGG
KPIVESMVILEYIEETWPDHPLLPKDAYERATARFWIQFGIDKGMAFFAFFRATEEEKEK
AAKEALEVLKILEEQCLGDKKFFGGENIGMVDIAYGWLAHWFEASEEMVGVKLVEPSTLP
RLHAWIQRLKEIPVIKENLPDRERLLVHFRRLRQMFLSDPSM
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggaagatgtgaagctgcatagtttctggcctagcccgtactgttacagagtgatatgg
gcactgaaactaaagggtatcagatatgagtacgtagaagaagacctttccaacaaaagt
caagcactattgcagtacaacccgattcataagaaggttccggtacttgttcatggcggc
aaaccaattgtggagtccatggttattcttgaatacatagaagaaacgtggccggatcat
cctttgctaccaaaagatgcttacgagagagccacagctcgattctggattcaatttgga
atagacaagggcatggcattttttgcatttttccgagcgactgaagaagagaaagagaag
gcagcaaaagaagcattagaagtgctaaaaatcctggaagagcaatgccttggagacaag
aagtttttcggaggggaaaacattgggatggtagatatagcatatgggtggctggctcac
tggtttgaagcctcggaagaaatggttggtgtgaaattggtggaaccaagcactttgcct
cgcttacatgcctggattcagcgtcttaaagaaattccagtgataaaagagaaccttcct
gatcgtgagagactgctggtgcattttagacgcttaaggcagatgtttctctcggacccg
tctatgtag

DBGET integrated database retrieval system