KEGG   Populus trichocarpa (black cottonwood): 18103612Help
Entry
18103612          CDS       T01077                                 

Definition
(RefSeq) succinate--CoA ligase [ADP-forming] subunit alpha-2, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
pop00020  Citrate cycle (TCA cycle)
pop00640  Propanoate metabolism
pop01100  Metabolic pathways
pop01110  Biosynthesis of secondary metabolites
pop01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pop00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    18103612
   00640 Propanoate metabolism
    18103612
Enzymes [BR:pop01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     18103612
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     18103612
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 18103612
NCBI-ProteinID: XP_024437665
Position
12
AA seq 339 aa AA seqDB search
MTRQAVAKLLGSIASRKPSSTPSVFNLSRSQTRNYAAPPPPPPAVFVDKNTRVICQGITG
KNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVIYVPPPFA
AAAILEAMEAELDLVVCITEGIPQHDMVRVKAALNRQSKTRLIGPNCPGIIKPGECKIGI
MPGYIHKPGRVGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIEKFLA
DSQTEGIILIGEIGGTAEEDAAALIKESGTEKPVVAFIAGQTAPPGRRMGHAGAIVSGGK
GTAQDKIKTLREAGVTVVESPAKIGVAMLDVFKQRGLAD
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgactcgtcaagccgtcgcgaaactactcggctcgatcgcgtcacgcaagccttcctcc
accccttctgtcttcaacctctcacggtcgcagactcgcaattatgcggcacctccacca
ccacctcctgcggttttcgtcgacaaaaacactcgcgtgatttgccaaggcatcactggc
aaaaacggcactttccacaccgaacaagccatcgagtacggcactaaaatggtaggaggt
gtcacgccaaagaagggagggacggagcacttagggcttccggttttcaacacggtggcg
gaagcaaaggcggaaaccaaggctaatgcttctgtcatttatgttcctccgccatttgct
gcggccgcaattttggaggcaatggaagctgaattggatcttgttgtgtgcattactgaa
ggaatacctcagcatgatatggtacgtgtgaaggctgctctgaacaggcaatctaaaact
cggttgattgggccaaactgccctggtattattaaaccaggagaatgtaaaataggtata
atgcctggttacatccataaacctggtcgtgttggaattgtttctcgatccggtactttg
acctatgaagcggttttccaaacaactgctgttggccttggacaatccacttgtgttggt
ataggaggagatcctttcaatggaacaaactttgttgattgtatagagaagttccttgca
gattctcaaacagaaggcatcattcttataggagagataggtgggactgcagaagaggat
gctgctgcattaataaaggaaagtggaactgagaagcctgttgtggccttcattgctgga
caaacagcaccaccaggccgtcgtatgggacatgctggagctattgtctcaggtggaaag
ggtacagcacaagacaaaatcaagaccctaagggaagctggagttactgtggtggagtct
cctgcaaaaattggtgttgctatgcttgatgtttttaagcagaggggtctcgcagattaa

DBGET integrated database retrieval system