KEGG   Populus trichocarpa (black cottonwood): 18104108Help
Entry
18104108          CDS       T01077                                 

Definition
(RefSeq) tyrosine decarboxylase 1
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
pop00350  Tyrosine metabolism
pop00360  Phenylalanine metabolism
pop00380  Tryptophan metabolism
pop00950  Isoquinoline alkaloid biosynthesis
pop00965  Betalain biosynthesis
pop01100  Metabolic pathways
pop01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pop00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    18104108
   00360 Phenylalanine metabolism
    18104108
   00380 Tryptophan metabolism
    18104108
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    18104108
   00950 Isoquinoline alkaloid biosynthesis
    18104108
   00965 Betalain biosynthesis
    18104108
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pop04147]
    18104108
Enzymes [BR:pop01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     18104108
    4.1.1.105  L-tryptophan decarboxylase
     18104108
Exosome [BR:pop04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   18104108
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2 Aminotran_5
Motif
Other DBs
NCBI-GeneID: 18104108
NCBI-ProteinID: XP_006375876
UniProt: U5FR59
Position
13
AA seq 495 aa AA seqDB search
MGSLSTNTFSPLDPNGFTNDSKMVIDFIADYYKNIENNPVQSQVKPGYLLTQLPDTAPYC
EESLEDVLKDVTDSIIPGLTHWQSPNFFAYFQANASTAGFVGEMLCTGLNVVGFNWIASP
AATELESIVMDWMGKMLKLPSTFLFSGNGGGVLHGSTCEAIVCTLVAARDETLRMIGAEN
ITKLVVYASDQTHSTLLKGVKLVGIPSSNFRCLSTSFSSEFSLSPQALEDAIENDIKAGL
VPLFLCATVGTTACGAVDPVMDLGEIARKYNLWFHIDAAYAGSACICPEFRHYLDGVELA
DSLSMNPHKWLLTNMDCCCLWVKQPRLLIESLSSDAEFLRNNASESSDVVDYKDWQIALS
RRFRALKLWIVIRRHGLANLMCHIRSDVNLAKRFESLVAKDSRFEVVVRRRFSLVCFRLK
HNDECQGLELNRKLLAAVNESGRAFMTHAVVGGLFIIRCAIGSTLTEERHVDDLWKLIQE
KAADLLSKKQVLLDN
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgggttctctatccacaaacactttctcccctttagacccaaatggtttcaccaatgat
tccaaaatggtgatcgatttcattgctgattattacaagaatattgaaaacaacccggtt
caaagccaagtgaaaccagggtacttattgacccaattgccagacactgccccatattgc
gaggaatccttagaagatgttctcaaagatgtaactgatagcattatcccaggcctcact
cattggcaaagccctaacttctttgcttacttccaagcaaatgcaagcactgcagggttt
gttggtgagatgctctgcacaggccttaatgttgttggcttcaactggattgcatctcct
gctgctaccgaactggaatccattgtaatggactggatgggaaagatgctcaagctccca
tctacttttttgttctcaggaaacggaggtggtgtcttgcacggtagcacttgtgaggct
atagtttgcaccctagttgcagcaagagacgagaccttgagaatgattggagctgaaaac
attacgaagctggtagtttatgcctctgatcaaacccattcaactctacttaagggcgtc
aaattagttggaattccatcctctaattttcgatgcctctctacctcattttcatcggaa
ttttcgttgtcacctcaagcattggaagatgcaattgaaaatgatatcaaagctggactt
gtgcccttatttttatgcgctactgtaggcactacagcatgtggagctgttgatcctgtt
atggatctgggggaaattgccaggaaatataatctatggttccacattgatgcagcttac
gcaggtagtgcatgcatatgccctgaattcaggcattacctggatggagtagaacttgca
gactcgttgagcatgaatccacataaatggttactcactaacatggattgttgctgcttg
tgggttaagcagcctcgtttattaatcgagtcactgtccagtgatgcagaattcttgagg
aacaatgccagtgaatcaagtgacgtcgtggactacaaagattggcaaattgcattgagt
aggcgattcagagctctgaagctttggattgtgattcgcaggcatggattagcaaacctt
atgtgccatattcgtagcgatgtgaacttggctaagcggtttgagtcactggtggctaaa
gacagtaggtttgaggtggtggtgcgaaggaggttttctctggtttgttttaggctgaag
cacaacgatgaatgccaaggcttggaattgaaccgtaagcttctagctgcagtgaatgaa
agtggtcgtgcattcatgactcacgcggtggttggtggcttgtttatcatacgctgtgcg
atcggatcaaccttgactgaagaacgacatgtagatgatttgtggaagttgattcaagaa
aaggcagcagatctcttgtcaaagaaacaggtgctattggataattaa

DBGET integrated database retrieval system