KEGG   Populus trichocarpa (black cottonwood): 18107148Help
Entry
18107148          CDS       T01077                                 

Definition
(RefSeq) cysteine-rich receptor-like protein kinase 10
Organism
pop  Populus trichocarpa (black cottonwood)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Stress-antifung DUF3403 Haspin_kinase APH Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 18107148
NCBI-ProteinID: XP_006373142
Position
11
AA seq 656 aa AA seqDB search
MGHNFLSDANTIQLLLLLYFSIATLSQHSSNFLTHPPYKFCSNTSLYEANSPFQNNLQTL
MSYLASNASVSNQYHAYAGNDPDIVYAQYMCYNYIENCSACIYAASQDIMQLCPNNRNAT
VWEELCQLRFSNKNFIGQLDISGNILLANKETIENSGQYISVVNEKFSNLTKKAAFDPTQ
NMYATGKLALSDIDTLYTLGQCTTDLSSHDCNTCLQVAIQNISSCCYIGRGQRLLSQSCY
FRFELYPFYEGTADSGETLTILKIVLGTCIPTVVLAFLTASCIIYFRRIRRKETDEEKSH
LAFLQELRKSSGSTFAEGNKVSSEELPWMMDLSVIRAATDNFSVSNKLGQGGFGSVYKGI
LSDGSEVAVKRLSRSSEQGVKEFKTEVLLIMKLQHKNLVRLLGFCVEGEEKLLVYEFMPN
SSLDVFLFDPTKRAELDWSSRIDIINGIAKGMLYLHEDSRLRIIHRDLKASNVLLDNEMN
PKISDFGMARIFSSNEDEANTARIVGTYGYMAPEYAMEGLYSTKSDVFSFGVLLLEIISG
RKKAGYHQSKCAPSLLAYAWQLWNEGNKTELIDPMLSDSCNADEFSRYMHIGLLCVQEDA
SDRPTMSSVVLMLQSQNSFLPQPERPAFVGRFMDNLEAAASNFSVNEMTLSDVGPR
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgggtcataattttctcagtgatgcgaacaccattcaattgcttttgttgttgtacttt
tccattgccaccctttcgcagcatagcagcaattttctcactcatccaccctacaagttt
tgctcaaacacatctctttacgaagctaatagtccatttcaaaacaatctccagaccctc
atgtcttatcttgcctcaaatgcttctgtgtccaatcaatatcatgcctatgctggaaat
gaccctgatatagtctatgctcaatatatgtgctacaactacatcgaaaactgcagtgcc
tgcatatatgcagcatcacaagatatcatgcaactctgtccaaacaatagaaatgcaact
gtatgggaagagctgtgccagttgcgcttctcgaataaaaatttcataggccagcttgat
atctcaggaaacattctcttagctaataaagagacgattgaaaattcaggacagtacata
tcagtagtgaacgaaaaatttagtaatcttaccaagaaggctgcttttgaccccacgcag
aatatgtatgctacaggaaaattagccttatcggatatagacaccctttatactctgggg
cagtgcactacagatttgtcatctcacgattgtaatacatgccttcaggttgccatacaa
aatatttcaagttgctgctatatcggtcgagggcaacggcttcttagtcagagttgctat
tttaggtttgagttatacccattctatgaaggcacagctgattcgggggagacattgacg
attttgaagattgtccttggaacttgtataccaacagttgttcttgcatttctcactgca
tcgtgtatcatctactttcggcgaataagaagaaaagaaacagatgaggaaaaaagtcac
cttgctttcttacaggaactgagaaaatctagcggatcgacattcgcagaaggtaataag
gtgagttctgaggaattaccttggatgatggacctgagtgttataagagctgcgacagat
aacttctctgtttcaaacaagcttggacagggtggatttggctctgtttacaaggggata
ctaagcgatggaagcgaagttgcagtgaagagactatcaagaagttcggagcagggcgta
aaagaattcaaaactgaagttctattaataatgaaacttcagcacaaaaatcttgtcagg
ctgcttggtttttgtgttgaaggagaggaaaagctcctcgtctatgaattcatgcctaac
agcagccttgatgtttttctttttgatcctacgaaacgagcagaacttgattggagcagt
agaattgatattataaatggaattgcaaagggaatgctttatcttcacgaggattctagg
cttagaatcattcatcgagacctaaaagcttctaatgtattgttagacaatgagatgaat
ccgaagatttctgactttggaatggcaaggattttttcaagtaatgaagacgaagccaat
actgctcgaatagtaggaacatatggatacatggcaccagaatatgcgatggagggatta
tattcaaccaaatctgatgtttttagttttggagttctcttgcttgagatcataagtggg
agaaagaaagctggataccaccaatcaaaatgtgctcctagcctcctggcatacgcttgg
caattatggaacgaaggaaataaaacagagttgattgatccaatgctgtctgattcatgc
aatgcagacgaattctcacgttacatgcacattggtttattatgtgttcaagaagatgct
agtgacagacctaccatgtcatctgttgtcttaatgctgcaaagccaaaattcatttctt
ccccaacctgagcggccggcttttgtgggaagattcatggacaacctagaggcagctgct
agcaatttctctgtcaatgaaatgacactttctgatgttggtccacgctga

DBGET integrated database retrieval system