KEGG   Populus trichocarpa (black cottonwood): 18107167Help
Entry
18107167          CDS       T01077                                 

Definition
(RefSeq) cysteine-rich receptor-like protein kinase 26
Organism
pop  Populus trichocarpa (black cottonwood)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Stress-antifung Pkinase_fungal CD34_antigen Haspin_kinase APH TMEM154
Motif
Other DBs
NCBI-GeneID: 18107167
NCBI-ProteinID: XP_024437134
Position
11
AA seq 683 aa AA seqDB search
MYSLRLIVLFSFSCVLLSSLSIAQPDFLYQSCRNTENNYTANSTFQKNLDSLLSSLASNT
QIDYGYYNFSAGQIGPDQVHAIALCRGDILLNECRGCVSNSGRKILQVCPNQKEAIGIYD
FCILRYSNRSSFGVLDEEFIVYTWNTENASHVNLFSQALGNLTSRLRTAAASGTSLLKFA
TGNQTAGIITIFGLVQCMPDLSAQDCDDCLAGTFQQIRSCCDGQIEGKIGGRIVRGSCYL
RFETYPFYRVTAATLAQLPLPPSPEAPPATENGNTTRKVVIIIVSILIFMAVVVITSIFL
YCRRPKQEVKSKLYFNENGGQECVQFRFASIRVATHNFSDDNKLGQGGFGAVYKGLLQDG
QAIAVKRLARNSAQGEVEFKNEVLLVARLQHRNLVRLHGFCFEGTEKLLVYEFVPNSSLD
QFLFDPSKRSLIDWEIRYQIIVGIARGVLYLHQDSQLRVIHRDLKASNILLDDQMNAKIS
DFGMAKLFQMDQTQDATSRIVGTLGYMAPEYAMHGCFSAKSDVFSFGVLVLEIITGRQNG
SFNSEDEQEYLLTNAWESWNQGRTLNLIDPILKRVVSRRDVLIRCFHIGLLCVQEKVADR
PTMASVILMLSSDSFVLPLPSRPPYCMHSAMEEQETSRPAQDIPSSREQPISTSSSLTNH
ESYPSDQSGIGHLESSIKEISNP
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgtattccttaagactaatagtgttgttttccttttcttgtgttcttctatcctcactg
agtattgctcaaccagatttcttgtaccagtcttgcagaaacaccgaaaacaactacaca
gctaacagcactttccaaaagaaccttgacagcctcctttcttctctggcctccaatacc
caaattgactacggatattataatttctctgctggtcaaataggccctgaccaagtacat
gcaattgcactttgtagaggagatattttgctgaatgagtgtcgaggttgcgttagtaac
tctgggcgtaagatcttacaggtttgtcctaaccagaaagaggcgataggaatttatgat
ttctgtattctacgatactccaacagatcctcgtttggtgtcttagatgaagagtttatt
gtttatacttggaacacagaaaatgcctcgcatgtgaatctattcagtcaggcacttgga
aacttaacaagtcgacttcgtacagctgcagcttcaggtacttcacttctaaagtttgcg
acaggaaatcaaacggcgggaatcattacaatatttggactcgttcagtgcatgcctgat
ttatcagcccaggattgtgatgattgcctggctgggacttttcaacagattcgaagctgt
tgtgatggacagatcgaaggaaaaattggagggagaattgtaagaggaagctgctattta
aggtttgaaacctaccctttttatagagttacagccgccacattagcacagctaccactt
ccgccatcgccagaagcaccgccagctacagagaatggcaatacaactcggaaagttgta
atcatcattgtttccatattaatcttcatggcagttgtagttatcacttccatctttctt
tattgtaggcggccaaagcaagaggtcaagagtaagttatatttcaatgaaaatggaggc
caagaatgcgtgcaattcagatttgcatccatcagagttgcaacacataacttctctgat
gataataagcttggacaaggtggttttggtgctgtttataagggtctgcttcaagatgga
caagcaatagctgtaaagagactagcaagaaattctgcacaaggagaagttgaatttaag
aacgaggtcctgttagtggcaaggcttcagcataggaatctagttaggctccatggtttc
tgcttcgaaggaacagaaaagcttctagtatatgagtttgtgcctaattcaagtctcgat
caattcttatttgatccaagcaagcgatcgctcattgattgggaaatacgctaccagatc
atagtaggcattgctcgaggagttctgtaccttcaccaagattctcagcttcgggttatt
catcgtgatctaaaagctagcaacattttgttagatgatcaaatgaatgctaaaatctcg
gattttggcatggcaaagctatttcaaatggatcaaacgcaagatgctacaagtagaatt
gtggggaccttgggctacatggctccagaatatgcgatgcatggatgcttctcagcgaag
tcagatgtttttagcttcggtgtgctagttttggagattattaccggtcgtcaaaatggt
tcattcaatagcgaggacgagcaagaataccttctcaccaacgcatgggagagttggaat
caaggaagaacattaaatctgatagatcctattctcaaaagggttgtttcaaggagagat
gtattgataagatgtttccacataggattactatgcgtccaagaaaaggtagcagataga
ccaaccatggcttcagttattctgatgcttagtagcgactctttcgttcttccattacca
tcaagacctccatattgtatgcactccgctatggaggaacaagaaacatcaaggccggca
caagatattccctcctctagagagcaaccaatatcaacatcaagttcattgactaatcat
gaatcatatccatcagatcaatctggaattggccatctcgaatcctccattaaagagatt
tcaaatccttag

DBGET integrated database retrieval system