KEGG   Populus trichocarpa (black cottonwood): 18107179Help
Entry
18107179          CDS       T01077                                 

Definition
(RefSeq) putative receptor-like protein kinase At4g00960
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
pop  Populus trichocarpa (black cottonwood)
Brite
KEGG Orthology (KO) [BR:pop00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pop01001]
    18107179
Enzymes [BR:pop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     18107179
Protein kinases [BR:pop01001]
 Serine/threonine kinases: TKL group
  IRAK family
   18107179
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Stress-antifung Pkinase_fungal APH Haspin_kinase Kdo PRIMA1 DUF3377
Motif
Other DBs
NCBI-GeneID: 18107179
NCBI-ProteinID: XP_024437044
Position
11
AA seq 677 aa AA seqDB search
MGSKTIVSLLFHVIIISITLTGAEVCYNTGNFTANSTYAKNRDLVLRSLASNVTANGGFY
NTTIGLGNDTVYGLVLCMASPSAENCSSCVNYAIQTLMAGCPNQKEAISWGGNPLPCIVR
YANRYFFGSLETSPTSAYYNEGILDATFRQFEQFWSGLGETVKNASTGSSRLMPAVETAD
LPSTQKIYVFMQCTPDVSPSNCSVCLQESVDYYKSCCYGNQGGLVLKPNCVFRWEIYTYY
DLFPQVTSPPPSPSPSPSPSPSPSPSSPPFVISSPPPTNTTIRKGKENTASRTVIVTIVP
TAIFLALVILILTVFHFRKPKQEVENFDEISIAKCLEFKFATIKLATNDFSDDNKLGQGG
FGAVYKGILADGQAIAVKRLSSNSGQGEVEFTNEVRLLAKLDHRNLVRLLGFCLEGTEKL
LIYEFVPNSSLDQFIHDPNKRFILDWEKRYKIIEGIARGILYLHQDSQLRIIHRDLKPSN
ILLDGKMNAKISDFGMAKLMKTDQTHDAASRIAGTFGYIAPEYARQRQFSVKSDVFSFGV
LVLEIVSGQKPSFRDGDDIEHLTSHAWRRWREGTALDLIDPILRNDSTAAMMTCIHIGLL
CVQENVADRPTMASVVLMLSNSSFTLQIPSKPAFFISRRTYRPASSSTSYTSRMTQSHLK
TVPPSKNEISITELDPR
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgggttctaaaactatcgtctctcttctttttcatgttattatcataagcatcactctt
accggtgctgaagtctgttataacacaggaaactttacagctaatagcacctatgcaaaa
aaccgagaccttgttctccgttcactagcttccaatgtcacagccaatgggggtttctat
aatactacaataggtttaggcaatgacacagtttatggtcttgtgctctgtatggcttcc
ccatcagctgaaaattgttccagctgcgtcaattatgctattcaaactctcatggcggga
tgtccaaaccaaaaagaagcaatttcatggggagggaatccacttccatgtattgtacgc
tatgcgaatcgttatttttttggatcacttgagacatctcctactagcgcttattataat
gagggtatccttgacgcaacttttagacagtttgaacaattttggagtggtttgggagaa
acggtaaaaaacgcttccacgggctcatccaggcttatgccagcagttgagacagcagac
ctaccatccactcaaaaaatttatgtatttatgcagtgcactcctgatgtatcaccgagt
aattgcagtgtttgcctacaagaatccgtagattactataaaagttgttgctacgggaat
caaggaggtcttgtcctgaaaccaaactgtgtttttcggtgggagatttatacctactac
gacttatttcctcaagtaacatctccaccaccatctccatcaccatcaccatcaccatct
ccgtctccatctccatcatctcctccatttgttattagttctcctccaccaaccaatacc
acaatcaggaaagggaaggagaatactgcttctcggacagttattgttaccatcgtccct
acagctatcttcttggcacttgttatcctcattctcaccgttttccattttaggaagcca
aagcaagaggtcgaaaatttcgatgaaattagtatcgcaaaatgcttggaattcaaattc
gccaccatcaaacttgcaacaaacgacttctctgatgataataagcttggacaaggtggt
tttggtgctgtttacaagggtatacttgcagacggacaagctatagctgtaaagagatta
tcaagtaattctgggcaaggagaagttgaatttacgaatgaggtacggctactagccaag
cttgatcaccggaatcttgtaaggttactggggttctgcttggaaggaacagaaaagctt
ctaatctacgagtttgtgcctaattcaagcctcgatcaatttatacatgatccaaacaaa
cgattcatcctggattgggagaagcgctacaaaatcatagaaggcatagctagagggatt
ctatacctgcatcaagattctcagctccggattattcatcgtgatctcaagcctagcaac
attctgttagatggaaagatgaatgctaaaatttcggattttggaatggcaaagttaatg
aaaactgatcaaactcatgatgctgcatcgaggatcgctggaacctttggctatattgct
ccagagtatgcaaggcaaagacagttctcggtcaagtcagatgtgtttagttttggagtg
ctagtcttggagattgtgagcggtcaaaaacctagtttccgcgatggagatgacatagag
caccttacgagccatgcatggagacgttggagggaagggactgctttagatcttatagat
cccattttgaggaacgactcaacagctgcaatgatgacatgcatccacatcgggttactc
tgcgttcaagaaaatgtagctgacaggccgacaatggcttcagttgttctgatgctaagc
aactcttcttttactttacaaataccttctaaaccagcattttttattagcagaagaaca
tatcgaccagcttcttcatcgaccagctatacttcaaggatgacgcaatcccaccttaag
actgtcccaccatcgaagaatgagatttcaattactgagttagatcctcgataa

DBGET integrated database retrieval system