KEGG   Populus trichocarpa (black cottonwood): 18108679Help
Entry
18108679          CDS       T01077                                 

Definition
(RefSeq) probable LRR receptor-like serine/threonine-protein kinase At1g07650
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
pop  Populus trichocarpa (black cottonwood)
Brite
KEGG Orthology (KO) [BR:pop00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pop01001]
    18108679
Enzymes [BR:pop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     18108679
Protein kinases [BR:pop01001]
 Serine/threonine kinases: TKL group
  IRAK family
   18108679
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Pkinase_fungal Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 18108679
NCBI-ProteinID: XP_024447744
Position
Unknown
AA seq 397 aa AA seqDB search
MGVICWKFYFRDKFMRERDLKGLDLKTGSFTLRQLRAATNNFDSAGKIGEGGFGSVYKGK
LSDGTFIAVKQLSPKSRQGNREFVNEIGMISGLQHPNLVKLYGCCIEGDQLLLVYEYMEN
NSLAKALFATGSETSFLMLDWPTRYKICVGIARALAFLHEESAIRIVHRDIKGTNVLLDK
DLSAKISDFGLAKLNEEENTHMSTRVAGTIGYMAPEYALWGYLTDKADVYSFGVVALEIV
SGRSNSSYRTTNEFVCLLDWAHVLQKKGNLMEIVDPKLQSEFNKEEAERMIKLALLCTNA
SPSLRPAMSEVVSMLEGQTSIQEMISDPSIYGDDLHSKLLKGHYQQVIDQSLNSTQDLFP
PSDKSWIGNSSASAHDLYPINPESINLNISETSTLIE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtcatttgttggaaattctattttagagacaagttcatgagagaacgagatctc
aaggggctagatctgaaaactggttccttcactttgaggcagctgagagctgccactaac
aattttgattctgctggcaaaattggagaaggtggatttggctccgtatacaagggtaaa
ttgtcagatggaactttcattgctgttaagcagctatctcctaaatccaggcaaggaaac
cgagaatttgtgaatgaaataggcatgatatctggtttacagcatcccaatcttgtaaag
ctttatggatgctgtattgaaggagatcagttgcttctagtgtacgaatacatggaaaac
aactccctcgccaaagcactttttgctacaggttcagaaacaagttttctgatgctggat
tggccaacaagatataagatatgtgttggaatagccagagctttagcatttctccatgaa
gaatctgcaatcaggattgttcacagagacatcaaaggtacaaatgtattactggacaaa
gatctaagtgccaagatatcagactttggactagctaagctcaatgaagaggagaacact
cacatgagcactcgtgttgctggaaccataggatatatggctccagaatatgcgctgtgg
ggttatttaacagacaaagcagatgtttatagttttggagttgttgctttagaaattgtc
agtggaagaagcaattcgagctacagaacaacaaatgaattcgtatgtcttcttgactgg
gcccatgtactgcaaaaaaagggaaatttaatggagatagtggacccaaagctgcagtct
gaattcaacaaggaagaggctgagaggatgatcaaattggctctcttatgcaccaatgca
tctccatctctaaggcctgcaatgtcagaagtggtgagcatgcttgaaggacagaccagc
atccaggagatgatctcagatcctagcatttatggtgatgatttacactccaaacttctc
aaaggccactatcagcaggtcatagaccagagtttaaacagcacacaagacctctttcct
ccatctgataaatcatggattggaaattcctctgcatctgcccatgatctttaccccatc
aatcccgagtccataaatttaaacatcagtgaaacctcgactttaattgaataa

DBGET integrated database retrieval system