KEGG   Populus trichocarpa (black cottonwood): 18109711Help
Entry
18109711          CDS       T01077                                 

Definition
(RefSeq) LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 2.4
Organism
pop  Populus trichocarpa (black cottonwood)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr WAK_assoc APH Kinase-like
Motif
Other DBs
NCBI-GeneID: 18109711
NCBI-ProteinID: XP_024448266
Position
Unknown
AA seq 672 aa AA seqDB search
MHPLTTTSSFLLTLFFSLHLTTSLLSNDTSNLSNCNQNFSCGDLTNVTYPFTGGLRPSHC
GPPEFGLTCDDESVTILKANSLSYRVTHLDQTSQTLRLSRSDLYDDGKCTRQFTNTTLDD
RIFSLGSSHELYLFYGCKKINDSGMGSDPLLKISRFSCENDGVTEEGFFSIVYPNGTEYS
FPNTFECQTNIRVPIPETRAQQLLENGSLVGEVLKEGFDVSYGNPYSANCTECYKKHPGG
YCGFDTQLGKPICICHDQLCPGSSRSGRRLQIAAGTSAAAAAILTLFVITIYLTRREGSF
SAVIAMTFRLKNSQHVGRVETFMMDYHSLTPKRYSYSDIKKMTNSFVNTLGEGGFGNVYR
GKLPDDGRLVAVKVLKESKGDGEEFMNEVASISRTSHVNVVTLLGFCYERNKRALIYEFM
PNGSLDSFISHKGSPHTNCRLEWKKLYEIAVGIARGLEYLHRGCNTRIVHFDIKPHNILL
DEDFCPKISDFGLAKLCQSKVSKISMIGARGTVGYIAPEVFCRSFGGVTYKSDVYSYGMM
VLEMVGQSKDFDMGSLETNELYFPDWFYMYLDPGEISIFHGGTTEEEKEIVKKMILVGLW
CIQTIPSHRPSMTKVVEMFEGSLQSLQIPPRPSLSSPRRSAQEYHSSTVSSLPCVSSQGG
GVKTLFADESDL
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgcaccccctcaccaccacctcctctttccttctcaccctctttttctccctccactta
acgacatcgcttctttccaatgacactagtaatctttcaaactgcaatcaaaacttctcc
tgtggtgacctcacaaacgtcacctacccgttcactggtggcctacgtccatcccactgc
ggtccaccggagttcggcctcacatgtgacgatgaatcagtcaccatcctaaaagctaac
tcactgagttaccgagtcactcatcttgaccagaccagccaaaccttaagactctcacgt
tcagacctctacgacgacggaaaatgcacccgccaattcactaacaccactctggatgac
agaatcttcagtcttggttccagccatgaactttatttgttttatggatgcaagaagatt
aacgactctggcatgggatcagatccgctgctaaaaatctctaggttctcttgtgaaaat
gatggagttacagaagaagggtttttctcgattgtttaccctaacggtactgaatattct
tttccgaatacgtttgagtgtcaaactaatattcgagtgccaattcctgagactcgggca
caacagcttcttgagaacgggtcattagttggtgaggttttgaaagaagggtttgatgtc
agttatggtaatccttacagtgctaattgtacagagtgttacaagaagcaccctggtggg
tattgtggatttgatacacagttgggtaaacctatttgcatttgtcatgatcagctctgt
cctggatcttctaggagtggtaggcgactacagattgctgcaggcacatcagcagctgcg
gcagcgatattaactttattcgtaattacaatatatctcactagaagggaaggttccttt
agtgctgtcatagcaatgaccttcaggctgaagaactcgcagcatgttggcagggttgaa
acatttatgatggactaccattctcttactccaaagcgttattcgtattcagacatcaag
aaaatgaccaactcattcgtcaatacactaggtgagggaggatttggtaatgtatacaga
ggaaagttaccagacgacggtcgtcttgtagctgtaaaagtcctaaaagagtccaaaggt
gatggagaagagttcatgaatgaagttgcaagcatcagtagaacttcccacgtgaatgta
gttacccttttggggttctgctatgagaggaataaaagagctttgatttatgaattcatg
cccaatggatctttagatagcttcatatctcataaaggatccccacatacaaactgtcgt
ttagaatggaaaaaattatatgaaattgcagttggtattgctagaggtctggagtacttg
catagagggtgtaacactcggattgtgcattttgacataaagcctcacaacattcttctt
gatgaagacttttgtccaaagatctcagattttggtctcgcgaagctatgccagagcaaa
gtaagtaaaatttcgatgataggtgccagaggaactgttggttacatagcgcctgaagta
ttctgcagatcttttggaggagtaacttacaagtctgatgtgtatagttatgggatgatg
gttcttgaaatggtcggacaaagtaaagattttgatatgggatcgttggaaaccaacgag
ttgtatttcccggattggttttatatgtatcttgatccaggagagatttcaatatttcat
ggaggtacaacggaggaggaaaaagagattgttaaaaagatgattttagtgggtttgtgg
tgcatccaaaccattccatcacatagaccatcaatgacaaaggttgtagagatgtttgaa
ggcagtcttcagtctttgcaaattccaccgagaccttccctttcctctcctagaaggtcc
gctcaagaatatcactcttccactgtatcatcactgccttgcgtgtcgtcccaggggggt
ggggtaaagacattgtttgcagatgaaagtgacttgtaa

DBGET integrated database retrieval system