KEGG   Populus trichocarpa (black cottonwood): 18111091Help
Entry
18111091          CDS       T01077                                 

Definition
(RefSeq) probable glycosyltransferase At3g42180
  KO
K18789  xylogalacturonan beta-1,3-xylosyltransferase [EC:2.4.2.41]
Organism
pop  Populus trichocarpa (black cottonwood)
Brite
KEGG Orthology (KO) [BR:pop00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pop01003]
    18111091
Enzymes [BR:pop01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.41  xylogalacturonan beta-1,3-xylosyltransferase
     18111091
Glycosyltransferases [BR:pop01003]
 Polysaccharide
  Structural polysaccharide
   18111091
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Exostosin
Motif
Other DBs
NCBI-GeneID: 18111091
NCBI-ProteinID: XP_024445315
Position
18
AA seq 467 aa AA seqDB search
MAVFNLDKLCLILPAFLFLLLLFPLGGQHHLTLLFSSFNPIKANSSTTPLEAPVLDAFAS
TSINTSNEDEPKTQKKRSSLERVEEGLSKARAAIQEAIRSKNYTSHKKETFIPKGSVYWN
SHAFHQSHIEMVKRFKVWPYKEGERPLVHDGPLNNIYSIEGHFIDEVESKGSPFRAQDPD
EAHVFFLPVSVASIVHFIYLPITAAADYSRDRLRRVVTDYVHIVAKKYPYWNRSNGADHF
MVSCHDWAPDVSIANSELFNKFIRVLCNANISVGFRPPRDVPLPEIYLPFSGLGTTHMGQ
APNNRPILAFFEGRAHGYIRQVLFKHWKNKDNEVQVHELLPKGKNYTRLMGQSKFCLCPS
GFEVASPRVVEAIYQGCVPVIISNNYSLPFSDVLNWSQFSVQIPVEKIPEIKMILQRISN
SKYLRMHERVKRVQRHFVLNRPAKPFDVIHMVLHSLWLRRLNFRLSD
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggcagtctttaacttggacaaattatgcttaatacttccagcttttctttttctcctc
cttctctttcccttgggtggtcagcaccatctcaccctactcttctcttctttcaatccc
attaaagccaacagctcaacaacaccactagaagcaccagtactggatgcatttgcttca
acctccattaatacaagcaatgaagatgagcccaagactcaaaaaaaaaggagtagcctg
gagagagtagaagagggtttatctaaggctcgtgcagctattcaagaagctattcgttcg
aagaactacacatcacacaagaaagagaccttcatccccaaaggatcagtatactggaac
tcccatgcttttcatcagagccatatagagatggtgaagagattcaaggtgtggccctac
aaggaaggagagaggccattggtccatgatggccctttaaacaacatctattccattgag
ggccatttcatcgatgaggtcgaaagcaaggggagcccattcagggcccaagatcccgat
gaggcccatgtattcttcctccccgttagtgtagcttctattgtgcacttcatctacttg
ccgatcacggcggcggcggattactctcgtgatcgcctccgccgggttgtgacggattac
gttcacattgttgccaagaagtatccttactggaatagaagtaacggtgctgatcatttt
atggtttcatgtcatgattgggcacctgatgtatcaatcgccaattctgagctcttcaac
aaattcattagagtcctctgcaatgccaacatctctgtagggttccggccaccaagagat
gtccctttaccggagatttaccttcccttttcaggccttggtacaacccatatggggcag
gctccaaacaaccgcccaattctagcattctttgaaggtagggctcatgggtatatcagg
caggtcttattcaagcattggaagaacaaagataacgaagttcaagtccatgagctgctt
ccaaagggcaagaattacacaagactaatgggtcaaagcaagttttgcttgtgccctagt
ggatttgaagtggcaagccctagagtcgtggaagcaatttatcaaggatgtgtgcctgtg
atcatttctaacaactattcattaccgtttagtgatgtccttaattggagtcaattctca
gtacagatcccagttgagaagataccagaaatcaagatgatcctgcaaagaatttctaac
agcaagtacttgagaatgcatgaaagagtcaagagagttcagaggcattttgtgctcaac
cgaccagctaaaccatttgatgttatccacatggtgcttcactcgttgtggcttcggagg
ttgaattttaggttgtcagactga

DBGET integrated database retrieval system