KEGG   Populus trichocarpa (black cottonwood): 7454600Help
Entry
7454600           CDS       T01077                                 

Definition
(RefSeq) magnesium protoporphyrin IX methyltransferase, chloroplastic
  KO
K03428  magnesium-protoporphyrin O-methyltransferase [EC:2.1.1.11]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
pop00860  Porphyrin and chlorophyll metabolism
pop01100  Metabolic pathways
pop01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pop00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    7454600
Enzymes [BR:pop01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.11  magnesium protoporphyrin IX methyltransferase
     7454600
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mg-por_mtran_C Methyltransf_25 Methyltransf_12 Methyltransf_23 Methyltransf_11 Methyltransf_31 PrmA MTS Methyltransf_32 Methyltransf_18 Ubie_methyltran CMAS CheR Methyltransf_9 UPF0020 TM1506 AviRa TehB TPMT AdoMet_MTase tRNA_U5-meth_tr
Motif
Other DBs
NCBI-GeneID: 7454600
NCBI-ProteinID: XP_002318168
UniProt: B9I3Z4
Position
12
AA seq 317 aa AA seqDB search
MAFTSSIFSHIPLSNQRIFPPNSHKPKPPRTTFTTAALPPLAAVTAADLDGTTLAVIGGG
SVAALAAAISLTDPERRRRLQAEEVGGGDKEVVREYFNNSGFQRWRKIYGETDEVNRVQK
DIRLGHSQTVENVLKMLKDEGSLEGVSVCDAGCGTGCLAIPLAKEGAAVYASDISAAMVA
EAEKQAKEQLQAGSEKELVMPKFEVKDLESLNGKYDTVVCLDVLIHYPQSKADGMIAHLA
SLAENRLLLSFAPKTFYYDLLKRVGELFPGPSKATRAYLHAEADVERALKKVGWKIRKRG
LVTTQFYFARLVEAIPA
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggcatttacatcctcaatattctctcacattcctttaagcaaccaaagaatattccct
ccaaattctcataaaccaaaaccacccagaaccaccttcaccaccgctgcacttccgcct
ctcgccgccgtcactgccgctgacctcgacggaaccaccttggctgtcatcggaggcggg
tcagtggcggctttagctgccgccatatcactcaccgaccccgaaaggcggcggcgcctc
caggcggaagaggtgggcggcggagacaaggaggtggtgagggagtacttcaacaattct
gggtttcaacggtggagaaaaatttatggagagactgatgaggttaatagagtgcagaaa
gatattaggcttggtcattcacagactgttgagaatgtgctgaagatgttgaaagatgaa
gggtcgttggagggtgtaagtgtttgtgatgctgggtgtggtactgggtgtttggccata
cccttggcgaaagaaggggcggctgtttatgctagtgatatttcggctgccatggtggct
gaggctgagaaacaggcaaaagagcagcttcaagcaggaagtgaaaaggagttggtgatg
cctaaatttgaagtgaaggatttagagagtttaaacgggaagtatgacacggtggtctgt
ctagatgttctgatacattacccacaaagtaaagcagatgggatgatcgcccatcttgca
tcattggctgagaatcgactacttttgagttttgctccaaagacattttactatgatctg
ttaaagagagtaggggagttgtttcctgggccttcaaaggcaacaagagcatatttacat
gcagaggcagatgtagagagggcattgaagaaggttgggtggaaaataaggaagagaggc
ctggttactactcagttctactttgcaagactcgtcgaagctattcctgcataa

DBGET integrated database retrieval system