KEGG   Populus trichocarpa (black cottonwood): 7456824Help
Entry
7456824           CDS       T01077                                 

Definition
(RefSeq) B3 domain-containing protein At2g33720
Organism
pop  Populus trichocarpa (black cottonwood)
SSDB OrthologParalogGFIT
Motif
Pfam: B3 DUF313
Motif
Other DBs
NCBI-GeneID: 7456824
NCBI-ProteinID: XP_002305818
UniProt: B9H2Z8
Position
4
AA seq 188 aa AA seqDB search
MEKHGGFGRGEVPWNQPRNKESAEELERSRVAFNLRRMRTSYTLGDLLEESSRGVSTHLS
LYHHYDPFTIKKKMKPSDLGNLCRLLVPSDLVEKYILPFLNTDQIKQVNQETNLGLKVSV
WDMNTQSMHQLVFKRWSTSRSYIFNDGWTKDFVRRRNLVEGDEIGLYWDTYHSRFNFNVL
SRAAAAAS
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atggagaaacatgggggatttggtagaggagaagtcccgtggaatcagccaagaaacaaa
gaatctgcggaagagttggagagatcgagggtggcttttaatcttaggaggatgagaacg
tcctacaccctgggggatctgttagaggagagttctcgtggggtatcaactcatctaagt
ttatatcatcattatgatccattcacgatcaagaagaagatgaaaccaagtgatttgggt
aatttatgcaggctgcttgtgccttcagatttggtggagaagtatatcttgcctttcttg
aatacggatcaaatcaaacaggtgaatcaagaaaccaatttgggtttgaaggtcagtgtt
tgggatatgaacacacagagcatgcatcagttggtcttcaagagatggagcacgtcgagg
agttatattttcaatgatggctggacaaaagacttcgttagaaggaggaatctcgttgaa
ggtgatgaaattggactctattgggacacttatcactctaggtttaatttcaatgttcta
agtagggctgctgctgctgctagctga

DBGET integrated database retrieval system