KEGG   Populus trichocarpa (black cottonwood): 7457704Help
Entry
7457704           CDS       T01077                                 

Definition
(RefSeq) G-type lectin S-receptor-like serine/threonine-protein kinase SD3-1
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
pop  Populus trichocarpa (black cottonwood)
Brite
KEGG Orthology (KO) [BR:pop00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pop01001]
    7457704
Enzymes [BR:pop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     7457704
Protein kinases [BR:pop01001]
 Serine/threonine kinases: TKL group
  IRAK family
   7457704
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase B_lectin S_locus_glycop PAN_3 PAN_2 PQQ_2 Sec66
Motif
Other DBs
NCBI-GeneID: 7457704
NCBI-ProteinID: XP_024442919
Position
1
AA seq 810 aa AA seqDB search
MCVTRNKGVNYEKFIEHFQGKTRKFERLSLALAVFVFLGSVFCCFCIEVAMVSVPLGFEI
SGFDRSRTWVSQNGVFAFGFLESCSKEDEVDSFVVGIRYNLGDNEAVNVPVWSVGGGLRV
SMNSTIRLSMDGRLILLDNPSGVIVWSSDTSSLGIRKASLLNNGNLVLVGIEDNVLWQSF
NSPTSTLLPGQSLHFPQTLRAPSKKSTSSYYSFVIRHSGELALVWENNVTYWSNHVNLLG
SVKEAILDGNGLLGLIDTSNKTMWSITSKDFDEPSPTLRRLKMDSDGNLRIYSWNHVLHE
WKVGWQAVENQCDVFGSCGLYSLCGLNSSGAVCDCLYQDSVNWGTGLSTVDSGSSGCKKM
VDLGNCKMNTSMMVMRQTFLYGLYPPQDVDIMLSEKACKEYCSNDTTCIAATSKNDGTGI
CTIKRTSFISGYGNPSVSATSFLKVCLVPQAVSARGANPHVTAKPIPTTRGGDGKNFTAA
IALIVLVTASGFLAIEMFVFWFMYRKRKIKAHVRIPFGKDAQMNAHYNSLIRLTFEEIKE
ITSDLANKLGPSVYKGALPNKTTVIVKALNDVTANEKDFRVAVSTLGRMHHRNLVLLMGF
CFEANNRFLMYEFVQNGSLDKWLLNMEPDHNEGTWQQRLDIALGVARALAYLHSECQICV
AHGNLKLENVLLDENFIPKLTDFGLGSLFEEEAASSSVSPSERDIYMFGEMLLQIVTCKR
DILSENLNHLVEKTNEEPNSEDSIISEEVERVVRIALWCMQNQPFLRPSIGEVVKVLEGT
LSVDRPPLGFAFRPDQMEGRVLTEVEVDSS
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgtgactaggaataaaggggtgaattatgagaaattcatcgagcattttcaaggt
aagactagaaagtttgaaaggcttagcttagctttagctgtgtttgtgtttttgggctct
gttttttgttgcttttgtattgaggttgctatggtatcagtgcctcttggttttgagatt
tcagggtttgatagaagtagaacttgggtgtctcaaaatggggtctttgcatttgggttc
ttagagagttgttcaaaagaagatgaagttgatagctttgttgtgggaattaggtataat
ttaggagataatgaagctgtaaatgttcctgtatggagtgttggtggtggtcttagggtc
tctatgaactccacgattaggctttccatggacgggaggctaattttgttagataaccct
agtggtgtgattgtttggagtagtgatacttctagtttaggtattagaaaggccagtctt
ttgaataatgggaacttagttcttgtgggtattgaagataatgtgctttggcaaagtttt
aatagcccaactagcactctccttcctggtcagtctttgcattttcctcaaaccctaaga
gccccttccaaaaaatcaacatctagttactacagttttgtgattcggcactccggagag
cttgctcttgtttgggagaataatgtgacctattggagtaatcatgtgaaccttcttggg
agtgttaaggaagcaatactcgatggtaatggtcttttggggcttattgataccagtaat
aaaaccatgtggtccataacaagcaaggattttgatgaaccttctccgacattgaggcgt
cttaagatggattctgatgggaatttgagaatctactcatggaaccatgtgctccatgaa
tggaaggttgggtggcaagcagttgaaaaccaatgtgatgtatttggttcatgtggtctt
tatagtttatgcgggcttaattcctctggagctgtctgtgattgtctttaccaggattcg
gtaaattggggaactggcctatccacagtggattcaggtagttccgggtgcaagaagatg
gtggatttggggaactgcaagatgaatacaagcatgatggttatgagacagacatttttg
tatggtctttatcctccccaggatgttgatatcatgctgagcgagaaagcttgtaaagaa
tactgctctaatgacacgacctgcattgcagcaacttcaaaaaatgatggtacgggtatt
tgcacaatcaagcgaaccagtttcattagtgggtacgggaatccttctgtttctgctact
tcattcttaaaagtgtgtctagtccctcaggctgtttctgctcgaggagctaatcctcat
gttactgcgaagccaattcccacaaccagaggaggtgacggcaagaacttcactgcagct
attgctttgatagttttggtaacagcatcaggttttctggccattgagatgtttgttttt
tggtttatgtaccgcaaacggaaaattaaagctcatgtaagaattccctttggcaaggat
gctcaaatgaatgctcattacaatagtcttatcagattaaccttcgaagagataaaagag
ataacatctgaccttgcaaataaacttggcccctctgtttataaaggtgcattaccaaac
aaaacaactgttattgtgaaggctctgaatgatgtgacagcaaatgagaaggatttccga
gttgcagtctctacattaggaagaatgcaccatcggaaccttgtgctattaatgggtttc
tgttttgaggccaacaacaggtttttaatgtatgagtttgtccagaatggttctctggat
aaatggctgctcaacatggaacctgaccacaatgaagggacatggcagcagagacttgac
attgcgcttggagttgctcgggcccttgcttatttgcactcagaatgtcagatatgtgta
gctcatgggaacttgaagctcgagaatgtcctgctcgatgaaaatttcattcctaaattg
actgattttggacttggaagcttgttcgaggaggaggcagcatcctcctcagtgtctcct
tcagaaagagatatctacatgtttggggagatgctgctgcaaattgtcacttgcaagagg
gatatactgagtgaaaatctgaaccatttggttgagaagacgaatgaagaaccgaactca
gaggatagcataatctctgaagaagtagaaagagtagtgaggatagctttgtggtgtatg
caaaatcagccctttttacgaccttccattggcgaagtggttaaggtattagaaggtaca
ctttctgtagataggcctccattaggttttgcttttagaccggaccagatggaagggaga
gttttaactgaggttgaagtagactcctcctag

DBGET integrated database retrieval system