KEGG   Populus trichocarpa (black cottonwood): 7458152Help
Entry
7458152           CDS       T01077                                 

Definition
(RefSeq) probable mediator of RNA polymerase II transcription subunit 37c isoform X1
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
pop03040  Spliceosome
pop04141  Protein processing in endoplasmic reticulum
pop04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:pop00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    7458152
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    7458152
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    7458152
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pop01009]
    7458152
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pop03041]
    7458152
   03009 Ribosome biogenesis [BR:pop03009]
    7458152
   03110 Chaperones and folding catalysts [BR:pop03110]
    7458152
   04131 Membrane trafficking [BR:pop04131]
    7458152
   03051 Proteasome [BR:pop03051]
    7458152
   03029 Mitochondrial biogenesis [BR:pop03029]
    7458152
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pop04147]
    7458152
Protein phosphatases and associated proteins [BR:pop01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     7458152
Spliceosome [BR:pop03041]
 Complex B
  Other components
   Prp19 complex
    7458152
 Complex C
   Prp19-CDC5 complex
    7458152
Ribosome biogenesis [BR:pop03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    7458152
Chaperones and folding catalysts [BR:pop03110]
 Heat shock proteins
  HSP70 / DNAK
   7458152
Membrane trafficking [BR:pop04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    7458152
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    7458152
Proteasome [BR:pop03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    7458152
Mitochondrial biogenesis [BR:pop03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    7458152
Exosome [BR:pop04147]
 Exosomal proteins
  Proteins found in most exosomes
   7458152
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Radial_spoke_3 Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 7458152
NCBI-ProteinID: XP_002316294
UniProt: B9HTJ7
Position
10
AA seq 648 aa AA seqDB search
MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
QVAMNPINTVFDAKRLIGRRFSDPSVQSDIKLWPFKVVAGPGDKPMIVVTYKGEEKQFSA
EEISSMVLIKMREIAEAFLGTSVNNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD
NRMVNHFVQEFKRKHKKDISGSPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFY
STITRARFEEMNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQDFF
NGKELCKSINPDEAVAYGAAVQAAILSGEGNERVQDLLLLDVTPLSLGLETAGGVMTVLI
PRNTTIPTKKEQVFSTYSDNQPGVLIQVFEGERARTKDNNLLGKFELSGIPPAPRGVPQI
TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKK
KVEAKNALENYAYNMRNTVKDEKIGSQLSPADKKKIEDAIDQAIQWLDSNQLAEVDEFED
KMKELESICNPIIAKMYQGAGPDMGGSMDEDIPSTGGSGAGPKIEEVD
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atggcaggaaaaggagaagggccagcgatcggtatcgatctaggcacaacatactcatgc
gtcggcgtatggcaacatgacagagttgaaatcatagctaatgatcaaggcaacagaacg
acaccgtcttatgttgctttcactgatacagagcgtttgattggcgatgctgctaaaaac
caggtcgccatgaaccccatcaacaccgtctttgatgcaaagcgtttgattggtaggaga
ttcagcgatccttcagttcagagtgatatcaagctctggccattcaaggtcgttgctggt
cctggtgacaagcctatgattgtggttacctacaagggcgaggagaaacaattttctgcc
gaggagatttcttcaatggttctcattaaaatgcgtgagattgctgaagctttccttggc
acctctgtcaataatgcggtagttactgtccctgcttacttcaatgactctcaaaggcag
gccacgaaggatgctggtgtcattgccggtctaaatgtcatgcgtattatcaacgaaccc
actgccgctgctatcgcttatggtcttgacaagaaggcaacgagtgttggcgagaagaat
gttctcatctttgatttgggtggtggtacttttgatgtctctcttcttaccattgaagag
ggtatctttgaggtgaaggccactgctggagatacccaccttggaggtgaggacttcgac
aacagaatggtgaatcactttgttcaggagtttaagaggaaacataagaaggatattagt
ggaagtcccagagctcttaggaggttgagaactgcctgtgagagggcaaaaaggactctg
tcatccactgctcagaccaccattgagattgactctctgtatgagggtattgacttttat
tcaaccatcactcgtgcaagatttgaggagatgaacatggatctcttcaggaagtgcatg
gagcctgtagagaagtgtttgagggatgctaagatggacaagagcactgtccatgacgtt
gtccttgttggtggttctactagaatccccaaggtgcagcagctgttgcaggactttttc
aatgggaaggagctttgcaagagcattaaccctgatgaggctgttgcttatggtgctgct
gtccaggctgcaatcttgagtggtgagggcaatgagagggtacaagatttgctacttttg
gatgtcactcctctttctctgggattggaaacagctggaggtgtcatgactgttttaatt
ccaagaaacaccaccatccccacaaagaaggagcaggtgttctccacctattcagacaac
caacctggtgtcttgatccaagtttttgagggtgagagagcaagaacaaaggacaataat
ttactgggaaaatttgagctatctggcattcctccagcaccaaggggtgttcctcaaatc
actgtgtgctttgatattgatgccaatggtatattgaacgtctctgctgaggacaagact
actggccagaagaacaagatcacaatcactaatgataagggaaggctgtcaaaggaggag
attgagaaaatggtacaggaagctgagaagtacaagtctgaggacgaggaacacaagaag
aaggttgaagctaaaaatgccttggaaaattatgcctataacatgagaaacaccgtgaag
gatgagaagattggatcccaacttagcccagctgataagaagaaaatcgaggatgcaatt
gatcaggccattcagtggttggacagcaaccagcttgcggaggttgatgaattcgaggac
aagatgaaagagctggagagcatttgcaatcctataattgccaagatgtatcaaggcgct
ggtcctgacatgggtggcagcatggatgaagatattccatcgactggaggcagtggtgct
ggccctaagattgaagaagtcgattga

DBGET integrated database retrieval system