KEGG   Populus trichocarpa (black cottonwood): 7461983Help
Entry
7461983           CDS       T01077                                 

Definition
(RefSeq) phosphatidylserine decarboxylase proenzyme 1, mitochondrial isoform X1
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
pop00564  Glycerophospholipid metabolism
pop01100  Metabolic pathways
pop01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pop00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    7461983
Enzymes [BR:pop01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     7461983
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-GeneID: 7461983
NCBI-ProteinID: XP_002304284
UniProt: B9GYC7
Position
3
AA seq 444 aa AA seqDB search
MKFRYSNKLPIFAHSLRLSHQHHQRRQFFTSLLKRVQTASQVRASFNGSSGNPRGNIFLV
PGATVATLLMLGALHARRLYDDKKVEEAREKGIEFEFQPDHKASFLRMLPLRSISRLFGS
LTSVELPVWMRPHVYRAWARAFHSNLEEVALPLENYASLREFFVRTLKEGSRPIDPDPHC
LVSPVDGTVLRFGELKGSGTMIEQVKGFSYSVSSLLGASSLLPVITEGDMHKESSEQQGN
LKEKNKKSWWRFSLASPKIRDTVSACPAKGLYYCVIYLSPGDYHLIHSPADWNVLVRRHF
SGHLFPVNERATRTIRNLYVQNERVVLEGLWEGGFMAIAAIGATNIGSIKLFIEPELQTN
QRRQKILNSEPPDERVYALEGVGKSLKKGAEVAAFNLGSTVVLVFQAPTLKMLQNRDSSS
EFRFSIRRGDRVRVGEALGRWHDL
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgaaattccggtattccaacaaactccctatttttgctcactctttacgtctgagccac
caacaccatcagcgacgccagttcttcacttcgcttctcaaaagggtccaaacagcatct
caagtacgtgcttctttcaatggaagcagtggaaatccccgaggtaatatatttctggta
cctggtgcaaccgtggccactttactcatgctcggtgctcttcatgctcgtcggctttat
gatgataagaaggtcgaagaggcgcgggagaaaggaattgagtttgagttccaacctgat
cataaagcgtcatttctgaggatgttacctttacgctccatttctagacttttcggttcc
ttgacaagtgtggaacttcctgtttggatgcgtccacatgtttatagagcatgggctcgt
gcattccattcaaacttagaagaagtagctctgcctcttgaaaactatgcttctttacgg
gaattctttgttcggaccttgaaagaaggttccaggcccatcgaccctgacccacattgt
ctggttagtcctgtggatggtactgttctaagatttggagagttgaaaggctcagggact
atgattgagcaagtcaaaggtttttcttattctgtttcttctcttcttggtgctagctcc
ttgcttcccgtgataactgaaggggatatgcacaaggagagtagtgaacagcaaggaaat
ctcaaagagaagaacaagaagtcatggtggagattttcattggcttctcctaaaatcaga
gacactgtgtcagcatgtccagcaaaaggtctctactactgtgtaatatacttgagtcct
ggagactatcatctgatacactcacctgctgattggaatgttcttgtccgccggcatttt
tcagggcatctatttcctgtgaatgaacgagctacaagaaccatcagaaatctttatgtt
cagaatgaaagggttgtgcttgaaggtttgtgggaaggaggattcatggctattgctgca
attggtgctacaaatattgggtcaattaagcttttcattgaaccagaacttcaaacaaac
cagcgaaggcaaaagatactgaattcagaacctccagatgaacgagtatatgcacttgaa
ggggttggtaaaagtctcaagaaaggggctgaggtggctgctttcaacttgggatcgaca
gtggtgctcgtgttccaggcccccacattaaaaatgctacaaaacagggattcatcttcg
gagtttaggttcagtatcagacgtggagatagagtgcgtgttggggaagctttggggagg
tggcatgacttgtaa

DBGET integrated database retrieval system