KEGG   Populus trichocarpa (black cottonwood): 7464624Help
Entry
7464624           CDS       T01077                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1 isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
pop00010  Glycolysis / Gluconeogenesis
pop00562  Inositol phosphate metabolism
pop01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pop00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    7464624
   00562 Inositol phosphate metabolism
    7464624
Enzymes [BR:pop01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     7464624
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     7464624
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 7464624
NCBI-ProteinID: XP_002315140
UniProt: B9HSJ9
Position
10
AA seq 493 aa AA seqDB search
MFAILKLLLLSISSQLNADQGFDVRRHLCTVTRYDVAKDMANTSAVAANNIPNGCTPIHV
NLVARHGTRSPNKKRMRELDKLASHLGELIREAEEQNLSLEKVPLWLRGWKSPWRGKLKG
GELIRKGEEELYNLGIRIRERFSELFDEEYHPDVYPIKATQVPRASASAVAFGMGLLSEK
GGLGPAQHRAFAVTSEIPASDIILRFHDCCGNYKDFKKRQEPAVDKLKEPVLDEITSALV
SRYGLKFTRQDTATLWSLCKQEASVLDITDRACGLFSPSEVALLEWADDLELFVLKGYGN
SINYRMGVPLLEDVVQSMEQAIKANEEKHPPGSYEKARLRFAHAETVVPFTCLLGLFLEG
SEFQKIRREEPLELPPKPPQSRNWRGSIVAPFAGNNMLVLHSCPANSASKYFVQVLHNEQ
PIPMTGCNGSDFCPFEEFKEKIVAPHLKHDYDSVCTAKLEEPEQKPASSKLSQLFRCLLS
LQNDDTRSTKDGL
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgtttgctattttgaagcttctgttgttatcgatatcgtcgcaattaaatgctgatcaa
ggtttcgatgtccgtcgccacctctgcactgtaacgaggtacgatgtagcgaaggatatg
gctaacacttcagctgtagctgccaataatattcctaatggatgcactcctatccacgta
aaccttgtggcaagacatggaactcgttctcctaacaaaaaacggatgagagagttagac
aagttggcttctcacttgggggaacttataagagaagctgaagaacaaaatttgtctttg
gagaaagttccgttgtggttgcggggatggaaatctccttggagagggaaattgaaaggt
ggagaattgatcaggaaaggagaagaagaattgtacaatcttggaatcaggattagagag
agattttcagaattatttgatgaggaataccacccagatgtttatcctataaaggctaca
caggttcctcgtgcatcagctagtgctgtggcatttggcatggggcttttaagtgagaag
ggaggtctaggacctgcacaacatcgagcttttgctgttacaagtgaaatccctgctagc
gacattatactgaggtttcatgattgttgtggaaactataaggattttaagaagaggcag
gagcctgctgttgataagctaaaggaacctgtactggatgaaatcacgtctgcattagtg
agccgctatgggctcaaattcactagacaggatactgctacgttgtggtctctgtgtaaa
caggaagcatctgtcctggatataactgatcgagcttgtggtcttttcagcccttccgag
gttgctttgctggagtgggcagatgatttggagctgtttgtattgaagggttatggtaat
tcaataaattatcgaatgggagtgccattgcttgaagatgttgtccagtccatggagcaa
gccattaaagcaaatgaagaaaagcatcctcctggaagttatgagaaggcaaggctacgg
tttgcacatgcagagaccgtggtcccatttacatgcctccttggactttttcttgaagga
tctgagttccagaaaatacgaagggaagaacctttggagctccctccaaaacctcctcag
agtagaaattggcggggcagcattgtggcaccttttgctggtaacaacatgctggtcctg
cacagctgcccggcaaactctgcaagcaagtactttgtccaagtactccacaatgaacaa
ccgattccaatgacgggttgtaatggttccgatttttgcccttttgaagagtttaaggaa
aaaatagtggctcctcatctgaagcatgactatgatagtgtgtgcactgcaaagctggaa
gaaccagagcagaaacctgcaagcagtaagttatcacaactgtttcgttgtctattatct
ctacagaatgatgatacacggtccaccaaggatggattatag

DBGET integrated database retrieval system