KEGG   Populus trichocarpa (black cottonwood): 7464858Help
Entry
7464858           CDS       T01077                                 

Definition
(RefSeq) probable protein S-acyltransferase 14
  KO
K20028  palmitoyltransferase ZDHHC2/15/20 [EC:2.3.1.225]
Organism
pop  Populus trichocarpa (black cottonwood)
Brite
KEGG Orthology (KO) [BR:pop00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pop04131]
    7464858
Enzymes [BR:pop01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     7464858
Membrane trafficking [BR:pop04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    7464858
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 7464858
NCBI-ProteinID: XP_024441060
Position
14
AA seq 307 aa AA seqDB search
MHRSRAVMAWNVFKFCTALRGLGSIMILLVLGVVGVTYYAVVLNNYGPALYDGGIDSLVS
LAVLIPFHSLLVMLLWSYFSVVLTDPGSVPPNWRPAIDEERGEADPLNGSEFSGVQSDQS
NQRIRYCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLE
TSLVTLSLSPHFIAFFSDGEIPGTPGTLATTFLAFVLNLAFALSVLGFLIMHISLVSANT
TTIEAYEKKTTPKWRYDLGRKKNFEQVFGADKRYWFIPTYSDDDLRRMPALQGLEYPSKP
DFDSQEF
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgcatagatccagagctgttatggcttggaatgtgttcaaattttgtacggccttaagg
ggtctaggctcgatcatgatcttgttggtgcttggcgttgttggtgtaacatattatgct
gttgttttgaataattatggccctgctttgtatgatggtggcatcgattctctcgtttct
cttgctgtcttgatcccattccattctttgttagtgatgctactgtggagttacttttct
gttgttttaactgatccgggcagcgtgcctcctaattggaggcctgctattgatgaggaa
agaggggaggctgacccgttgaatggatcagagtttagtggagtgcagtctgaccaatca
aatcaaagaatccgatattgccggaagtgcaaccagctgaaaccacctcgttgccatcat
tgttctgtttgtgggaggtgtgtgctaaagatggaccatcattgcgtatgggttgtaaat
tgtgttggggccttgaattataagtattttcttctatttttgttctacacatttcttgag
acaagtcttgtaactttatctctttcaccacactttatagcattctttagtgatggagaa
attcctgggactcctggcacccttgcaaccacatttcttgcctttgtcttaaatctggcg
tttgcattgagtgttctgggatttctgatcatgcacatatcgcttgtgtctgctaatact
acaactattgaggcatacgagaagaagaccaccccaaaatggcgctatgaccttggtcga
aagaagaattttgagcaggtgtttggggcagataagcgatactggttcattccgacttat
tcagacgatgatttacggcgaatgcctgcacttcagggtcttgaatatccatcgaaaccc
gactttgattcccaggaattctag

DBGET integrated database retrieval system