KEGG   Populus trichocarpa (black cottonwood): 7465577Help
Entry
7465577           CDS       T01077                                 

Definition
(RefSeq) beta-amyrin synthase
  KO
K15813  beta-amyrin synthase [EC:5.4.99.39]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
pop00909  Sesquiterpenoid and triterpenoid biosynthesis
pop01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pop00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    7465577
Enzymes [BR:pop01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.39  beta-amyrin synthase
     7465577
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SQHop_cyclase_C SQHop_cyclase_N Prenyltrans Pec_lyase
Motif
Other DBs
NCBI-GeneID: 7465577
NCBI-ProteinID: XP_002310349
UniProt: A0A3N7F5S0
Position
7
AA seq 760 aa AA seqDB search
MWRLKIAEGVSSNELYSTNKFVGRQTWEYDPHGGSPEERAEVEEARLSFYNNRYHVKPSG
DLLWRMQFLKEKNFKQKIPQVIIEDGEEITYEKATNALKRAVHFFSALQASDGHWPAENA
GPLFFLPPLVMCLYITGHLDSVFSVEHRREILRYIYYHQNEDGGWGLHIEGHSTMFCTVL
SYICMRILGEGPSGGQDNACARARKWIHDHGTATHIPSWGKTWLSILGVFDWSGSNPMPP
EFWLLPSFLPMHPAKMWCYCRMVYMPMSYLYGKRFVGPVTPLVLQLREELFAEPYGQVNW
RKTRHLCAAEDLYYPHPLIQDLVWDSLYVFTEPFLTRWPFHKLVRKKALEVTMKHIHYED
ENSRYITIGCVEKVLCMLACWVEDPDGDYFKKHLARIPDYLWVAEDGMKMQSFGSQQWDT
GFAIQALLASNFTDEIIDVLKRGHDFIKKSQVKDNPSGDFKSMYRHISKGSWTFSDQDHG
WQVSDCTAEGLKCCLLFSMMPPEIVGEQLEPERLFDSVNVLLSLQSENGGLAAWEPAGAQ
KWLELLNPTEFFADIVVEHEYVECTASAIQALLLFKNLYPGHRKKEIDNFVTNAARYLES
IQTPEGGWYGNWGVCFTYGTWFALGGLAAAGKTYSTCTAMRQGVNFLLNIQKDDGGWGES
YLSCPKKKYVPLEGNRSNLVHTAWAMMGLIHAGQMDRDSAPLHRAAKLIINSQLEDGDFP
QQEITGVFMKNCMLHYAAYRNIYPLWALAEYQRRVLLPSK
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atgtggaggctaaagattgcggaaggtgtgagcagcaatgagttgtatagcacaaataag
tttgtagggaggcagacatgggagtatgatcctcacggtggaagtcctgaggagagagct
gaggttgaagaagctcgtctcagtttctacaacaaccgttatcatgtcaagcccagcggc
gacctcctctggcgtatgcagtttctcaaggagaaaaactttaagcaaaaaataccgcaa
gtgataattgaagatggcgaggagatcacatatgaaaaggcaacaaatgcattgaagagg
gctgtccacttcttttcagctctacaggctagtgatggccactggcctgctgaaaatgct
ggccccttgttcttcctccctcccttggtaatgtgtctgtacattacaggacatctagat
tctgtattctctgttgagcatcgtagggaaatcctccgttacatctattatcatcagaat
gaagatggtggttggggactccacattgagggtcacagcaccatgttctgcacagttctc
agctacatttgtatgcgaattctcggggaaggacccagtggtggtcaagacaatgcttgt
gccagagcccggaaatggattcatgatcatggtactgcaacacacataccctcttgggga
aagacttggctctcgatacttggtgtatttgattggtctggaagtaatccgatgccccca
gaattttggctccttccctcttttcttcctatgcatccagcgaaaatgtggtgctattgt
cggatggtttacatgccaatgtcgtatctatatgggaaaaggttcgttggtcctgttaca
cctctcgttctacagttgagagaagaactctttgctgaaccttatggtcaagtcaattgg
aggaaaacgcgtcatctgtgtgctgcggaggatctctactatccccatcctttgattcaa
gatctggtatgggatagtctctatgtattcaccgaaccttttcttactcgttggcccttc
cacaagttagtaagaaagaaggctcttgaagtaacaatgaagcacattcactatgaagat
gaaaacagtcgttacattacaatcggatgtgtggaaaaggtgttatgcatgcttgcttgc
tgggttgaagatcccgatggcgattatttcaagaaacatctcgctaggatccccgattat
ttatgggtggctgaagatggaatgaaaatgcagagttttggaagtcagcaatgggatact
ggttttgccattcaggccttgcttgctagtaattttacggatgaaatcatagacgtactc
aagagaggacatgacttcataaagaaatctcaggtcaaggacaatccttccggtgacttt
aagagcatgtaccggcatatttctaagggatcctggactttctctgatcaagatcatgga
tggcaagtttctgattgcactgcagaaggattgaagtgctgcctacttttctcaatgatg
ccaccagaaattgttggcgagcaactcgagcctgagcggcttttcgattctgtcaatgtt
cttctttctctacaaagtgaaaatggaggtttagcggcgtgggagccagctggagctcag
aagtggttggaactactgaatcctacagagttttttgctgacattgtcgttgagcatgaa
tatgttgagtgcactgcatcagcaatccaagcgttattattgttcaagaatttgtaccct
ggtcaccggaagaaggagatcgataattttgtaacaaatgctgcacgatacctcgaaagc
atacaaactccagagggcggatggtatggaaactggggagtttgcttcacttatggtaca
tggtttgcacttggaggcctagcagctgctggcaagacttacagcacctgcacagctatg
cgccaaggtgttaattttcttctcaacatacaaaaagatgatggaggttggggagagagc
tatctttcatgccctaagaagaaatatgtacctcttgaaggaaatcgatcgaatttggta
catactgcatgggcaatgatgggtctgattcatgctgggcagatggatagagactctgca
cctcttcaccgagcagcgaagcttataatcaattcgcaattggaagatggtgatttccct
caacaggaaatcactggtgtgttcatgaaaaactgcatgctacattatgcagcatacaga
aatatctatccattgtgggctcttgcagaataccagaggcgtgttcttctgccttcgaaa
taa

DBGET integrated database retrieval system