KEGG   Populus trichocarpa (black cottonwood): 7465857Help
Entry
7465857           CDS       T01077                                 

Definition
(RefSeq) probable phospholipid hydroperoxide glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
pop00480  Glutathione metabolism
pop00590  Arachidonic acid metabolism
pop01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pop00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    7465857
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    7465857
Enzymes [BR:pop01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     7465857
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 7465857
NCBI-ProteinID: XP_002303583
UniProt: A9PDN5
Position
3
AA seq 238 aa AA seqDB search
MLTSRSRILSQKYLNFASLSASFLLSKQSSFNSKQTLLPSLHNSPVSLHSQSIKAGVSRR
LLGSVRFNHSMASQSSPQSAHDFTVKDAKGNDVDLSIYKGKVLLIVNVASQCGLTDSNYT
ELTQLYAKYKDQGLEILAFPCNQFGSQEPGSSEEIVEFACTRFKAEYPIFDKVEVNGNNA
APIYKYLKSSKGGLFGDNIKWNFSKFLVDKEGKVVDRYAPTTSPLSIEKEVKKLLGIA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgctcacttctcgctctcgcattctctctcaaaaatatctcaactttgcatcgttatct
gcttctttcttattatcaaaacagtcatctttcaattccaagcaaacccttttgccatct
ttgcataactcaccagtttctttacattctcagtcaatcaaagcaggggtttcaaggcgt
ttattgggttctgtaagattcaatcattcaatggcaagccaatccagtcctcaatctgct
catgatttcactgttaaggatgctaagggaaatgatgttgacctcagcatttataagggg
aaggtcctcttgattgtcaatgttgcttcacaatgtggcttgaccgattcaaactacacg
gagctgacccagctatatgcaaaatacaaggatcaaggtttggagattctggcttttccg
tgcaatcaatttggatctcaggagcctgggagcagtgaagagattgtggagtttgcttgc
actcgctttaaggctgaatatcccatatttgataaggttgaagtgaatggtaacaacgct
gctccaatttacaaatacttgaagtctagcaagggtggactttttggggacaacattaaa
tggaatttttccaagttcctggtagataaagaaggcaaagttgtggatcgttatgctccc
actacctcccctcttagcattgagaaagaggtgaagaaacttctggggattgcttaa

DBGET integrated database retrieval system