KEGG   Populus trichocarpa (black cottonwood): 7468064Help
Entry
7468064           CDS       T01077                                 

Definition
(RefSeq) pyruvate decarboxylase 2
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
pop00010  Glycolysis / Gluconeogenesis
pop01100  Metabolic pathways
pop01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pop00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    7468064
Enzymes [BR:pop01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     7468064
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C CO_dh
Motif
Other DBs
NCBI-GeneID: 7468064
NCBI-ProteinID: XP_002308230
UniProt: B9HCY7
Position
6
AA seq 605 aa AA seqDB search
MDTKIGSPDTCKPTSNDMINPTNATVSTVQNSVSSTIINPSQSTLGRHLARRLVQIGVTD
VFSVAGDFNLILLDHLIAEPGLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSV
LNAIAGANSENLPVICIVGGPNSNDYGTNRILHHTIGLPDFSQELRCFQTVTCYQAVVNN
LEDAHEQIDTAISTALKENKPVYINVSCNLSAIPHPAFCREPVPFSLSPKISNELGLEAA
VEAAAEFLNKAVKPVLVGGPKLRPAHASEAFVELADACGYALAVMPSAKGLVPEHHPHFV
GTYWGAVSSAFCAEIVESADAYLFAGPIFNDYSSVGYSLLLKKEKAIIVQPDRVMIANGP
AFGCVLMKDFFVALAKKIKPNTTAYDNYQRIFVPEGEPLRNAPEEPLRVNVLFQHVQKML
SSETAVIAETGDSWFNCQKLKLPRGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVIACI
GDGSFQVTAQDVSTMLRCRQNTIIFLINNGGYTIEVEIHDGPYNVIKNWNYTSLVDAIHN
GEGKCWTAKVFCEDELVEAIETATGPEKDSLCFIEVIVHKDDTSKELLEWGSRVSAANSR
QPNPQ
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atggacaccaagataggatctcctgacacttgcaaaccaacaagcaacgacatgatcaac
ccaactaacgccaccgtatcaaccgtccaaaactcagtctcatccaccattatcaaccca
tcccagtcaacactgggtcgccacctcgctcgccgactcgtccaaatcggtgtcactgac
gttttctctgtcgctggtgacttcaatctcattctccttgatcacttgatcgccgagcct
gggctcaaccttatcggttgctgtaacgagctcaacgcgggctatgctgctgatggatac
gcccggtcacgtggtgtaggcgcgtgtgttgtcacgttcactgttggtggactcagtgtg
ctaaatgctattgctggtgctaatagtgagaatttgcctgtcatatgcattgttggtggg
cccaactcgaatgattatgggactaacaggattttacaccataccattggcttgcctgat
tttagccaggaactaagatgtttccagaccgttacttgctatcaggctgtggtgaataac
ttggaggacgcacatgaacagatagatactgctatttcaactgctttgaaagaaaacaag
cctgtttacatcaatgttagctgtaacttgtcagcaatccctcatcctgctttttgtcgg
gagccagttccattttcgctctcccccaaaattagtaatgaattgggcttagaggctgca
gtggaagcggctgccgaattcttgaacaaggcagtgaaacctgttttggtgggtggccct
aaactaagacctgcacatgcaagtgaggcatttgtggagttagctgatgcatgtggttat
gcgctcgctgttatgccatcggctaaggggcttgtgccagagcatcatccacatttcgtt
gggacttattggggtgcagtgagctctgcattctgtgctgagattgtggagtccgcggat
gcttacttgtttgctggacctattttcaatgattatagctccgttgggtattctcttctt
ctcaagaaggagaaggcgattatcgtgcagcctgatcgtgtgatgattgcaaatggacct
gcatttggctgtgttctgatgaaagatttcttcgtggctcttgcgaagaagatcaagccc
aacactactgcttatgataattaccaaagaatatttgttcctgagggggaaccattgaga
aatgcacccgaagaacctttgagggttaatgttctgttccaacatgtacagaagatgctg
tctagtgaaactgctgtgattgctgagactggagactcatggtttaactgtcagaagctg
aaattgccaaggggatgcgggtatgagttccaaatgcagtatggatcaattggttggtca
gttggtgctactcttgggtatgctcaggctgtgccagagaagcgtgtgattgcttgcata
ggtgatggtagctttcaggtaactgctcaagatgtgtctactatgctacgatgtagacag
aacaccatcatcttcctcatcaacaatggtggatacacaattgaagtcgagatccacgac
ggtccttataatgtgattaagaactggaactacactagcttggttgatgccatccacaat
ggcgaaggcaagtgctggacagccaaggtgttctgcgaggatgagctggttgaagcgatt
gagacagcaacaggaccggagaaggatagcttgtgcttcattgaggttattgttcacaag
gatgataccagtaaagaactgttggaatgggggtctagggtctctgctgccaatagccgt
caaccaaaccctcagtag

DBGET integrated database retrieval system