KEGG   Populus trichocarpa (black cottonwood): 7468486Help
Entry
7468486           CDS       T01077                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP62 isoform X2
  KO
K09571  FK506-binding protein 4/5 [EC:5.2.1.8]
Organism
pop  Populus trichocarpa (black cottonwood)
Brite
KEGG Orthology (KO) [BR:pop00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pop03110]
    7468486
Enzymes [BR:pop01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     7468486
Chaperones and folding catalysts [BR:pop03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    7468486
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C TPR_1 TPR_2 TPR_8 FKBP_N_2 TPR_19 TPR_11 TPR_12 TPR_16 Fis1_TPR_C TPR_14 LemA TPR_9 ANAPC3
Motif
Other DBs
NCBI-GeneID: 7468486
NCBI-ProteinID: XP_002321107
Position
14
AA seq 577 aa AA seqDB search
MEEDFEFPTGSNNMELEDEMDMGIPDPDEAVIKVGEEKEIGKNGLKKKLVKEGEGWDTPS
AGDEVEVHYTGTLVDGTQFDSSRERGTPFKFKLGQGQVIKGWDEGIKTMKKGENAVFTIP
PELAYGESGSPPTIPPNATLQFDVELLSWTSVKDICKDGGIFKKIIVEGEKWDNPKDLDE
VFVKYEARLENGTVVSKSDGVEFTVGEGYFCPALAKAVKTMKKGEKVLLTVKPQYGFGEN
GRTAAGDEGAVPPNATLEIMLELLSWKTVSDVMKDKKVMKKILKEGEGYERPDDGTVVQV
KLIGKLEDGTIFVKKGHEEEPPFEFKIDEEQVIDGLDRTVKTMKKGEVALVTIQPEYAFG
RSESQQDLATVPVNATVYYEVEMISFTKEKESWDMNTQEKIEAAGKKKEEGNAWFKAGKY
ERASRRYEKAAKFIEYDSSFTDEEKQQSKVLKISCKLNNAACKLKLKDYKEAEKLCSKVL
ELDGQNVKALYRRAQAYIQLVDLDLADIDIKRALEIDPDNRDVKLEYKILKDKVREYNKK
EAQFYSNIFAKMNKLEQTNSTMAAKQDAMPMTIDSKA
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atggaggaagactttgagttcccaactggaagcaacaacatggaacttgaagatgaaatg
gacatgggtatcccggacccagatgaagctgttatcaaggtgggtgaagagaaggagatt
ggcaaaaatgggctgaaaaagaagctcgttaaggaaggtgaaggctgggatacccccagt
gccggtgatgaagttgaagtgcactacactggaactttagttgatggaacccagtttgat
tcgagccgtgagagagggactccatttaagttcaagcttggccaagggcaagtaattaag
ggatgggatgagggcatcaaaactatgaaaaagggcgagaatgctgtttttactatacct
ccagagttggcgtatggtgaatctggctctcctccaactattcctcccaatgctactctt
cagttcgacgtggagttgctatcgtggacaagtgtcaaagacatatgcaaagatggagga
atctttaagaaaataattgttgagggagaaaaatgggataatcccaaagatctcgatgaa
gtatttgttaagtatgaagcgcggcttgaaaatggcacagttgtctcaaagtctgatgga
gttgaattcactgttggagaaggctatttctgtcccgccttggcaaaggctgtgaaaaca
atgaagaagggggagaaagtgttgctgacagtgaaaccacaatatgggtttggagagaat
ggcaggacagcagcaggtgatgaaggtgctgttcctccgaatgctacccttgagataatg
cttgagctgctttcctggaagactgtgtctgatgttatgaaggacaagaaggtcatgaaa
aagatcctgaaggaaggagaaggttatgaacgacctgatgacgggactgttgttcaagtg
aaactaattgggaagctggaagatgggactatctttgtgaagaagggccatgaagaggag
ccaccatttgagttcaagatagatgaagagcaagttattgatggactagatagaaccgta
aagactatgaagaaaggggaagttgctctggtgacaattcaaccagaatatgcttttggc
cgatctgaatctcaacaagacttggctactgttcctgtcaatgcaacagtgtactatgaa
gttgagatgatctccttcaccaaggaaaaggaatcttgggatatgaatacacaagagaag
attgaagctgcagggaagaagaaagaagaagggaatgcatggttcaaggctggcaaatat
gaaagagcctcaagaagatatgagaaggcagcaaagtttatcgagtatgactcatctttc
actgacgaggagaagcagcaatcaaaggtgctgaaaatttcctgcaagcttaacaatgca
gcgtgcaagctgaagctcaaggactacaaggaagctgagaagctttgctccaaggtgtta
gagcttgatggtcagaatgtgaaggccttgtataggagggctcaagcgtatatacagctt
gtcgatttggacctggcagacatagacattaaaagggcacttgaaattgaccctgacaac
agggacgtcaagctggagtacaagatcctgaaggacaaagtgagagagtacaacaagaag
gaagcgcaattttatagcaacatatttgcgaagatgaataagttagagcaaacaaattca
actatggcagcaaagcaggatgcaatgccaatgaccatagatagcaaggcttaa

DBGET integrated database retrieval system