KEGG   Populus trichocarpa (black cottonwood): 7468509Help
Entry
7468509           CDS       T01077                                 

Definition
(RefSeq) dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex 2, mitochondrial
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
pop00020  Citrate cycle (TCA cycle)
pop00310  Lysine degradation
pop00380  Tryptophan metabolism
pop01100  Metabolic pathways
pop01110  Biosynthesis of secondary metabolites
pop01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pop00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    7468509
  09105 Amino acid metabolism
   00310 Lysine degradation
    7468509
   00380 Tryptophan metabolism
    7468509
Enzymes [BR:pop01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     7468509
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 RnfC_N GCV_H
Motif
Other DBs
NCBI-GeneID: 7468509
NCBI-ProteinID: XP_002321131
Position
14
AA seq 474 aa AA seqDB search
MIWGIIRRNLASSQSVSRIKHPAIRPRGYGQNELLSNGKGCRHAVGSFSYCTSLGSQCCR
AYSNKPRREITAMLRPEYFIPLRSRSFSSDTGDLVDAVVPFMGESITDGTLAKFLKNPGD
RVEVDEPIAQIETDKVTIDVASPEAGTIQQLVAKEGETVEPGTKIAVISKSGEGVPQAAP
PSQEKTASQPPPPAEKESIGKGTTKTETSSLKGKEKTLFPPQPAARAPSSPPKPSEPQLP
PKERERRVPMTRLRKRVATRLKDSQNTFAMLTTFNEVDMTNLMKLRSDYKDAFVEKHGVK
FGFMSGFVKAAVSALQYQPVVNAVIDGDDIIYRDYIDISIAVGTPKGLVVPVIRNSDQMN
FAEIEKNINTLAKKATAGTISIDEMAGGTFTISNGGVYGSLLSMPIINPPQSAILGMHSI
VTRPMVVGGNIVPRPMMYIALTYDHRLIDGREAVYFLRRIKDVVEDPRRLLLDV
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgatctggggaattattcgacgcaatctcgcttcgtctcagtcagtctcgcgaattaag
catccggcgataaggccgagaggttacggccaaaacgagcttctgagcaatggtaagggg
tgtcggcatgccgtcggcagctttagttattgcacttccttagggagccaatgttgtcgt
gcatattcgaataagccgaggagggaaattactgcaatgcttcgaccagaatattttatt
ccattgaggagtagatcattttcttcagatactggagatctggttgatgcagttgtccct
ttcatgggtgaatctattactgatggcaccttggcgaaattcttgaaaaatcctggtgac
agggttgaagttgatgagcccattgcacagattgaaactgacaaggtgacaattgatgtg
gctagtcctgaagccggcaccattcaacagcttgtagccaaggaaggtgaaactgtggaa
ccgggtaccaaaattgctgttatttcaaaatcaggtgaaggtgtaccacaagctgctccg
ccctcacaagaaaagactgcttctcagcccccgcccccagcagaaaaagagagtatagga
aaaggaacgactaagactgaaacttcctctctcaaaggaaaggaaaaaacactgtttcca
ccacaaccagcagccagagctccttcatcacctcctaaaccttcagaaccgcaacttcca
cctaaggaaagagaaagaagagttcccatgacaaggctgaggaaacgggttgcaacacgg
ttgaaagattcgcaaaatacatttgcaatgctgaccacattcaatgaggttgatatgact
aatttgatgaagcttcgttcagattataaggatgcatttgttgaaaagcatggagtgaag
ttcggatttatgtcaggatttgtcaaggctgctgttagtgcacttcagtatcagccagtt
gtcaatgctgtaattgatggagatgatatcatatacagagactacattgatataagcatt
gccgttggcactccaaagggccttgttgttccagttatccgcaattctgatcaaatgaac
tttgctgagatagagaagaacatcaacactctagctaagaaagcaactgctggtaccata
tcgattgacgagatggctggaggtactttcacaatatctaatggcggggtttatggaagc
cttttgagcatgccaattatcaaccctcctcagtctgctattttgggcatgcactctata
gtcacccggccaatggttgttgggggcaacatagtcccaaggccaatgatgtacattgca
ttgacatatgatcatcgactgatagatggaagggaggctgtttatttcttacgccgcatc
aaagatgttgtggaggaccctcgtaggcttcttcttgatgtatga

DBGET integrated database retrieval system