KEGG   Populus trichocarpa (black cottonwood): 7469898Help
Entry
7469898           CDS       T01077                                 

Definition
(RefSeq) ubiquitin-conjugating enzyme E2 2
  KO
K10573  ubiquitin-conjugating enzyme E2 A [EC:2.3.2.23]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
pop04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:pop00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    7469898
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pop04121]
    7469898
   03400 DNA repair and recombination proteins [BR:pop03400]
    7469898
Enzymes [BR:pop01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     7469898
Ubiquitin system [BR:pop04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   7469898
DNA repair and recombination proteins [BR:pop03400]
 Eukaryotic Type
  TLS (translesion DNA synthesis) factors
   Rad6 epistasis group
    7469898
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UQ_con Prok-E2_B RWD
Motif
Other DBs
NCBI-GeneID: 7469898
NCBI-ProteinID: XP_002325860
UniProt: A9PD36
Position
19
AA seq 152 aa AA seqDB search
MSTPARKRLMRDFKRLQQDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLTLQFT
EDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNS
PANSEAARMFSETKREYNRRVREVVEQSWTAD
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaccccagccaggaagaggttgatgagggatttcaagaggctgcagcaggatcca
cctgccggcatcagtggtgctccccaagacaacaacatcatgctttggaacgctgttatt
ttcggacctgatgatactccatgggatggagggacgtttaagttgactcttcaattcacg
gaggattatccgaataaacctccaacagtccgatttgtttcacggatgtttcatccaaac
atttatgcagatggaagtatatgcttggacatcttacaaaatcagtggagtccgatatat
gatgttgctgctatacttacctccatccagtctctgctctgtgatccaaacccaaattcc
ccagcaaactctgaagccgctcgcatgttcagtgagactaagcgggagtacaaccgcaga
gttcgtgaagtagtggagcagagctggacggctgactga

DBGET integrated database retrieval system