KEGG   Populus trichocarpa (black cottonwood): 7470681Help
Entry
7470681           CDS       T01077                                 

Definition
(RefSeq) U-box domain-containing protein 52
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
pop  Populus trichocarpa (black cottonwood)
Brite
KEGG Orthology (KO) [BR:pop00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pop01001]
    7470681
Enzymes [BR:pop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     7470681
Protein kinases [BR:pop01001]
 Serine/threonine kinases: TKL group
  IRAK family
   7470681
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH DUF465 PIP49_C
Motif
Other DBs
NCBI-GeneID: 7470681
NCBI-ProteinID: XP_024459363
Position
6
AA seq 602 aa AA seqDB search
MKIAPDFCSVYVITKGKILSSKKAQRMPPSSAPQKTPSMPAVSSRSQQDNAELDSDGVRA
QTRKRECRSTEPGGFPSDKVHDLIREPQHEGGRKPISNFSMESTDPPFSAGRLSTFRYST
SDASQNTGTFALAIMDSSAQGLDKSIASASSLNESNADFLEAEMRRLRLELKQTMAMYST
ACKEALSAKKKATGLNQWKVDEVRKFEETKLAGEAALAMAELEKAKCRVAIEAAEKSQKL
AEMEARKRKQAEMKAERETGEKNRALNALAHNDVRYRRYTIEEIEEATDKFSPSNKIGEG
GYGPVYKGKLDHTPVAIKALRPGAAQGKKQFQQEVEVLSTIRHPHMVLLLGACPEYGVLI
YECMDNGSLEDRLLQKDNTPPIPWSTRFKIAAEIATALLFLHQTKPEPLVHRDLKPANIL
LDRNYVSKISDVGLARLVPPSIADSVTQYHMTSAAGTFCYIDPEYQQTGMLTTRSDIYSM
GIMLLQIITAKPPMGLAHQVGRAIERGGFSDMLDHTVSDWPVEEALRFAILALKCAELRK
RDRPSLATVIVPELNRLRDFGMNSEQQQSRGVSSRGRSCSPLPQPTSPLQARMSNATQVG
QY
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgccccggatttttgttctgtttatgtaatcactaaaggaaagatcctctct
tccaaaaaagcacaacgaatgcctccttctagtgcaccgcaaaagacaccatctatgcca
gcagtttcatctcgaagtcagcaggataatgctgaactagattcagatggagttagagca
cagacaaggaagagagagtgtagaagtacagaaccaggtggatttccttcggacaaggtc
catgatctcattagagaaccacaacatgagggaggaagaaagcccatttctaatttctca
atggaaagcactgaccctcccttctctgccggaagactctcaactttccgttattctaca
tctgatgcatctcaaaatacagggacattcgcgttggcaatcatggacagctcggcccaa
ggtttagataagtctattgcttcagcctcctctctgaacgagtcaaacgcagacttctta
gaagctgagatgagaagactgaggcttgagctgaagcaaaccatggcaatgtacagcaca
gcttgcaaagaagcactttcagccaaaaaaaaggctactggacttaatcaatggaaggtt
gacgaggttcgtaagtttgaggaaaccaagctcgcaggagaggcagctcttgccatggca
gagctggagaaggccaagtgcagagttgccattgaagcagctgagaaatcacagaaacta
gcagagatggaagctcggaaaagaaagcaggcggagatgaaagctgagcgagagacaggg
gagaagaatcgtgctttgaatgctttggcacacaatgatgtacggtacagaagatacact
attgaagagattgaagaagccacggataaattctcaccatcaaataaaattggtgaagga
ggatatggacctgtgtataaaggcaaacttgatcataccccggttgccatcaaggcttta
agacctggtgctgctcaagggaagaagcagttccaacaggaggttgaggttctcagcacc
attagacacccacacatggtccttcttcttggtgcctgccctgagtatggagtcttgata
tatgaatgcatggacaacggaagcttggaagacaggctgcttcaaaaagacaacacccct
ccaattccatggagcacacgattcaaaatagctgctgagattgccacagcccttcttttc
ctccaccaaacaaagccagagccccttgtccaccgggaccttaagccagcaaatattctt
ttagaccgtaactatgtgagcaaaattagtgatgttggccttgctcgtttagtccctcct
tctatagctgatagtgtcacacaataccacatgacctcagctgcaggtacattttgttat
atagatcccgagtatcaacaaacaggaatgttaactacaagatcagacatttactcaatg
ggaataatgttactccaaatcatcacggccaagcctccgatgggtcttgcacatcaggtg
gggagggccattgaaagaggaggattttcggacatgcttgaccacacagtatcggactgg
cctgtggaagaggcgttaagatttgctatactggcattgaagtgtgctgaactaaggaag
agagacaggccaagtcttgccacagttatagtgccagaacttaaccggttgagagacttt
ggaatgaactcagaacagcagcagagccgtggagtaagcagcagaggtcgtagttgcagt
cctcttccacaacctacgtcacctttacaggcaaggatgtcgaatgcaactcaggttggt
caatattga

DBGET integrated database retrieval system