KEGG   Populus trichocarpa (black cottonwood): 7480121Help
Entry
7480121           CDS       T01077                                 

Definition
(RefSeq) non-specific phospholipase C2
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
pop00562  Inositol phosphate metabolism
pop00564  Glycerophospholipid metabolism
pop00565  Ether lipid metabolism
pop01100  Metabolic pathways
pop01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pop00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    7480121
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    7480121
   00565 Ether lipid metabolism
    7480121
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:pop02042]
    7480121
Enzymes [BR:pop01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     7480121
Bacterial toxins [BR:pop02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   7480121
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosphoesterase DUF1778
Motif
Other DBs
NCBI-GeneID: 7480121
NCBI-ProteinID: XP_002298470
UniProt: B9GG81
Position
1
AA seq 527 aa AA seqDB search
MQQNMSAKRPPKLAPSIFLFLLVLLHDQIHASPIKSVVVLVMENRSFDHMLGWMKKINPE
INGVDGTQWNPLNITDPNSPKFFFNNQAQYVDPDPGHSFQAIREQIFGSEDTSKNPPPMN
GFAQQAFSMDPSTNMSRDVMNGFEPDMLAVYRALVSEFAVFDRWFASVPSSTQPNRLFVH
SGTSAGATSNIPAMLAKGYPQRTIFENLDDAGISWGIYYQNIPATLFYRNLRKVKYTSRF
HPYDSSFKKDAGKGKLPGYVVIEQRYTDLKTAPANDDHPSHDVYRGQMFVKEVYETLRAS
PQWNETLLVITYDEHGGFYDHVATPVIGVPSPDGIVGPAPFFFKFDRLGVRVPSIMVSPW
IEKGTVVHGPNGSPFPTSEYEHSSIPATVKKLFNMTTFLTKRDEWAGTFEGIVQTRTEPR
TDCPEQLPIPTRIRKSEPNEDAKLTEFQQELLQLAAVLKGEDTLTSYLEKIGKEMTVKQG
NDYMEDAVKRFLEAGLHATRMGVDEEQIVQMRPSLTTRTSKPTTNQP
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaaaacatgtccgcaaaaagaccacctaaactagccccttccatcttcctcttc
ctccttgtactcctccatgaccaaatccatgcaagcccaataaaaagtgttgtggtatta
gtgatggaaaatcgttcttttgatcacatgctaggttggatgaagaaaatcaaccctgaa
atcaatggtgttgatggcactcagtggaatccactgaacataacggatccaaattcacca
aaattcttcttcaataaccaagctcagtatgttgaccctgatcctggccactcttttcaa
gcaataagggagcagatatttgggtctgaagacacgtccaagaatcctcctcccatgaac
ggctttgctcaacaggctttctctatggacccatcaaccaacatgtcccgggatgtgatg
aacggattcgagcctgatatgctagctgtttacagggcacttgtatcggaatttgctgtc
tttgacaggtggtttgcttcggttccatcatctacacaacccaaccggctatttgtgcat
tcaggcacatctgccggagccaccagcaacatcccggcaatgctcgctaaggggtaccct
caaagaacaattttcgaaaaccttgacgatgctggaatatcttggggaatatactaccag
aacatcccggccacattgttttataggaacctaaggaaggtcaagtacacttctagattc
catccttatgactcgtcgtttaagaaggatgcgggaaaaggcaagcttcctggttatgtt
gtgattgagcagcggtacacggacttgaagacagcccctgccaacgatgatcatccttcc
catgatgtttatcgagggcaaatgtttgtcaaagaggtgtacgagacactaagggcaagt
ccacaatggaatgagacactgttagtaatcacatacgacgagcatggtgggttctacgat
cacgtggctacacctgtaattggggtccctagtccggacgggattgtgggaccagcgcct
ttttttttcaagtttgatagactcggggttagagttccctctatcatggtctccccgtgg
atagagaagggcaccgttgtccacggacccaatgggtcaccatttccaacgtcagaatac
gagcactcatccattcctgcgacggtgaagaagctcttcaacatgaccactttcttgaca
aagagggatgaatgggcgggtacctttgaaggcatcgtacagactcggactgagcctaga
actgattgcccagagcaactaccgattccaactcggatcaggaagagtgagcccaatgaa
gatgccaagcttaccgaatttcagcaggagctactacagcttgcagctgtgctaaaagga
gaggatactttgacgagttaccttgaaaagatagggaaggaaatgacagtcaagcaaggg
aatgattacatggaggatgcagtgaaacgattcttggaagcaggccttcatgctacgagg
atgggagtcgatgaagaacaaattgttcaaatgaggccctccctcactacaagaacatcc
aaaccaacaaccaatcaaccatga

DBGET integrated database retrieval system