KEGG   Populus trichocarpa (black cottonwood): 7480142Help
Entry
7480142           CDS       T01077                                 

Definition
(RefSeq) mitogen-activated protein kinase 7 isoform X2
  KO
K20537  mitogen-activated protein kinase 7/14 [EC:2.7.11.24]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
pop04016  MAPK signaling pathway - plant
Brite
KEGG Orthology (KO) [BR:pop00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    7480142
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pop01001]
    7480142
Enzymes [BR:pop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     7480142
Protein kinases [BR:pop01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   7480142
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kdo Kinase-like APH Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 7480142
NCBI-ProteinID: XP_002310268
UniProt: B9HF94
Position
7
AA seq 368 aa AA seqDB search
MATLVEPPNGIRPRGKQYYSMWETVFEVDSKYVPIKPIGRGAYGVVCSSINRETNEKVAI
KKINNVLENKIDALRTLRELKLLRHIRHENVIALKDVMMPIHRRSFKDVYLVYELMDTDL
HQIIKSSQPLSNDHCKYFIFQLLRGLNYLHSANILHRDLKPGNLLVNANCDLKICDFGLA
RTSRGDEQFMTEYVVTRWYRAPELLLCCDNYGTSIDVWSVGCIFAEILGRRPIFPGTECL
NQLKLIISVLGSQNDTELEFIDNPKARRYIKTLPYARRIHFSHLYPQADPLAIDLLLRML
VFDPTKRISVTEALLHPYMSGLHDPRHDPPARVPINLDIDENLGEHMIREMIWDEMLHYH
PEVVFANR
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggcaactttagtggagcctccaaatggaattaggccaagagggaagcaatattactca
atgtgggaaactgtgtttgaggttgattcgaagtatgttccgattaagcctataggtaga
ggggcctatggtgttgtttgctcttcgattaatagggaaacaaacgagaaagtcgccatc
aagaaaatcaataatgtgcttgagaacaagattgatgctttgaggactctcagagagttg
aagcttcttagacatatccggcatgagaatgtgattgctttgaaggatgttatgatgcct
attcataggagaagtttcaaggatgtgtatttggtttatgagcttatggatacagatttg
catcagattatcaagtcctcgcaaccactttccaatgatcattgcaagtattttatattt
cagttgctgcgcgggctgaattatctccactctgcaaacattcttcatcgggacttgaag
cctggaaatctccttgtcaatgccaactgcgatctgaagatatgtgattttgggctggca
cgaactagcagaggtgatgaacagttcatgactgagtatgttgtcacccgctggtatcgt
gcacctgagctgctactctgctgtgacaactatggaacctccattgatgtctggtctgtc
ggatgtatctttgctgagattcttggccgcagacctatcttccctggaacagagtgtctt
aaccagctgaagctaattatcagtgtccttgggagccagaatgatactgagcttgagttc
attgataacccaaaagccagaaggtacatcaaaacacttccttatgcaaggagaatccat
ttttcacatctataccctcaagctgatcctttggccatagacttgttgctaaggatgctg
gtgtttgatcctactaagagaattagtgtgacagaagcacttctacacccttacatgtca
gggctgcacgatccaagacacgacccaccagcacgggttcctatcaatcttgacatagat
gagaatcttggggaacatatgattagggagatgatatgggatgagatgcttcattaccac
ccagaagttgttttcgcaaatagatag

DBGET integrated database retrieval system