KEGG   Populus trichocarpa (black cottonwood): 7480188Help
Entry
7480188           CDS       T01077                                 

Definition
(RefSeq) phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
pop00010  Glycolysis / Gluconeogenesis
pop00020  Citrate cycle (TCA cycle)
pop00620  Pyruvate metabolism
pop00710  Carbon fixation in photosynthetic organisms
pop01100  Metabolic pathways
pop01110  Biosynthesis of secondary metabolites
pop01200  Carbon metabolism
Module
pop_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
pop_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
Brite
KEGG Orthology (KO) [BR:pop00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    7480188
   00020 Citrate cycle (TCA cycle)
    7480188
   00620 Pyruvate metabolism
    7480188
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    7480188
Enzymes [BR:pop01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     7480188
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPCK_ATP APH_6_hur
Motif
Other DBs
NCBI-GeneID: 7480188
NCBI-ProteinID: XP_024461413
Position
7
AA seq 664 aa AA seqDB search
MAANGNGEMAMNGKGAATARKPKGLLPSITTSDKHHDVCHDMSAPTVKAQTIDELHSLQK
KKSAPTTPIKGFQSTFAALSEEERQKQQLQSISASLASLTRETGPKVVRGDPASKSQTSP
RVHQQHVAEPAISASDSSLKFTHVLYNLSPAELYEQAIHYEKGSFITSTGALATLSGAKT
GRAPRDKRVVKDDVTGEELWWGKGSPNIEMDEHTFMVNRERAVDYLNSLDKVFVNDQFLN
WDPENRIKVRIVSARAYHSLFMHNMCIRPTPEELEDFGTPDFTIYNAGQFPCNRYTHYMT
SSTSIDLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKRRILSLHSGCNMGKDGDVALF
FGLSGTGKTTLSTDPNRYLIGDDEHCWTETGVSNIEGGCYAKCIDLSREKEPEIWNAIKF
GTVLENVVFEEHTREVDYADKSVTENTRASYPIEYIPNAKIPCVGPHPKNVILLACDAFG
VLPPVSKLNLAQTMYHFISGYTALVAGTEEGVKEPRATFSACFGAAFIMMHPTKYAAMLA
EKMQKHGATGWLVNTGWSGGSYGSGSRIKLAYTRKIIDAIHSGSLLKAEYKKTKVFGLEI
PTEVEGVPSEILDPVNTWSNKLGYEDTLMKLAGLFKNNFETFTDHKIGKGNELTEEILAA
GPNF
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaaacgggaacggagagatggcgatgaatgggaaaggagctgcaacggcaaga
aaaccgaagggactcctgccaagtatcaccacaagtgacaagcatcatgatgtctgccat
gatatgagcgcaccaaccgtgaaggcccagacaattgacgagctccactctcttcaaaag
aagaaatcagcacccactactcccattaaagggtttcagagtacctttgctgctctctcc
gaagaagaacgccagaaacagcagctccagtccatcagtgcatctttggcgtcgttgacg
agagaaacaggaccgaaagtggtgagaggagaccctgctagcaagagccagaccagccca
agggttcaccagcaacatgtagctgaacccgccatcagcgccagcgacagctccttgaag
ttcactcacgtcctctacaacctctcccctgccgagctttatgagcaggccatacactat
gagaaagggtccttcataacatcaactggtgcattggctaccctttccggtgccaaaact
ggtcgggctccgagagataaacgtgttgtcaaggatgatgttaccggagaagagctttgg
tggggaaagggttcacccaacattgaaatggacgagcataccttcatggttaacagagaa
agagctgttgattacttgaattctctggacaaggtctttgtgaacgatcaattcttgaac
tgggaccctgagaacagaatcaaagtccggattgtttctgccagagcctaccattcactc
ttcatgcacaacatgtgtatccggcccactcctgaagagctggaggatttcggtactccg
gacttcactatatacaatgcaggccagttcccatgtaatcgttatacacactacatgaca
tcctctactagtatagatctgaaccttgctagaagggaaatggtcatcctcggcacacag
tacgccggggaaatgaagaagggtctgttcagtgtaatgcattatctcatgcctaagcgt
cgaatcctctccttacattctggctgcaatatgggaaaagatggagatgttgccctcttc
tttggactgtcaggtaccgggaagacaactctgtctactgatccaaacagatatctaatt
ggagatgacgagcattgctggactgagaccggagtgtcaaatattgaaggcggatgctat
gccaaatgcattgatctctcaagggagaaggagcctgaaatctggaatgccatcaagttt
ggaactgtgctggaaaacgtggtgttcgaggagcacactcgagaggtggattatgctgat
aaatccgttacagagaacactcgagcatcctaccctatcgagtacattcctaatgcgaag
ataccatgtgttggtccgcacccaaagaatgttatccttttggcatgtgatgcatttggt
gtactcccaccagtgagcaagctgaacttggcacagaccatgtatcatttcatcagtggc
tataccgctttggtggctggcacagaagagggtgtgaaggagccaagggcaacattctca
gcttgctttggtgcagcatttataatgatgcaccctaccaaatatgcagctatgctggct
gagaagatgcagaagcatggtgcaacaggatggcttgtcaacactggctggtcaggtgga
agctatggttcaggaagccgtatcaagttagcatacacaaggaaaatcattgatgccata
cattctggcagtctcttgaaggcagaatacaagaaaactaaggtgtttgggctagagatc
cccaccgaggttgagggagtgccctctgaaatcctggatccagtgaacacttggtcaaac
aaactaggctacgaggacaccctgatgaagctggcaggtttgttcaagaataactttgag
acattcactgatcacaagattggaaagggcaacgagctcacagaagagatcctcgcagcc
ggtccaaatttctaa

DBGET integrated database retrieval system