KEGG   Populus trichocarpa (black cottonwood): 7481447Help
Entry
7481447           CDS       T01077                                 

Definition
(RefSeq) protein S-acyltransferase 18 isoform X1
  KO
K20027  palmitoyltransferase ZDHHC1/11 [EC:2.3.1.225]
Organism
pop  Populus trichocarpa (black cottonwood)
Brite
KEGG Orthology (KO) [BR:pop00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pop04131]
    7481447
Enzymes [BR:pop01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     7481447
Membrane trafficking [BR:pop04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    7481447
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 7481447
NCBI-ProteinID: XP_002302807
UniProt: B9GTA3
Position
2
AA seq 506 aa AA seqDB search
MISMATRRHGWQRPLHPLQMIGMAVYSFLVVTFYTFLGLFLGNRIAEITVTAIFTFVAVP
VMFLFVRCTAIDPTDKTRFRKKKRAKSDGFPKLNYWFILNQIIMRFFRRMERKILKTFIR
RKYLDPLKANAQMEPLLPFPLVMKDDAVSPDPKDDDISYCSLCDFEVKKRSKHCRACNRC
VEGFDHHCRWLNNCVGKRNYTTFFLLMIFVLLMLIIEGGTAIAIFIRCFTDKKGIERELE
RRLHVEFPRGVLATISVLLVLMTAYSSAAMGQLFFFHVVLIRKGMRTYDYILAMKEVNES
IELDPLEDSDLSSDSDFDSPEKSTIVSRFCGHRENENPASLSIKIDRGDPESSNLTKKQG
FRASINPWKLIKLSREKAVLAAEKARERIMKQKPVEQPNSLRPLPSETKCGPLMNQNKNV
INVESGSTPLISEGRVPVSLGSLSSPRRRFSGSQSMFSGYIPSPKNKYSSSFDLKLTEVS
RELETYISRQVLCSVMKKDAQEASPK
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgatatccatggccacgaggcgccatggttggcaacgccctctccaccctttacagatg
ataggaatggcagtttacagttttctggttgtgaccttctatacattccttggacttttc
cttggaaacagaattgctgaaattacagtcactgcaatctttacttttgtggcagttcca
gttatgttcctgtttgttaggtgtactgccattgatccgactgataagaccaggtttagg
aagaagaaaagagctaaatcagatgggtttccaaagttaaattattggtttatattgaat
caaataatcatgaggttttttagaaggatggaaagaaagatccttaaaacctttataagg
agaaagtatttggacccattgaaggccaatgctcaaatggagccattgcttccatttcca
cttgtcatgaaggatgatgcagtttcacctgacccaaaagatgatgacatctcttattgc
tcgctatgtgattttgaggtaaagaagcgaagtaagcactgtagagcctgtaacaggtgt
gttgaagggtttgatcaccattgcaggtggttaaacaattgtgttggcaagaggaattac
acaactttctttcttctgatgatatttgtcttgttaatgttaatcatagaaggaggaact
gccattgccatatttataaggtgctttactgataagaaaggaatagaaagggagctggag
aggaggctacatgtggagttcccaagaggggttcttgccacaatatcagttttgttggtt
ttaatgacagcttatagttcagcagccatgggacaacttttcttttttcatgtggttctc
atacgcaagggaatgagaacatatgattatatcctggccatgaaagaggtaaacgaatca
attgaactagatccattggaagattcagatctctcttcagactcggattttgactctcct
gaaaaatcaacaattgtttcacggttttgtggccatagagaaaatgagaaccctgcaagt
ctgtcaataaaaattgataggggggatcctgagtcttccaacttaaccaagaaacaaggc
tttcgtgcaagcatcaatccatggaaactaatcaagttgagcagagagaaagctgtgcta
gcagctgagaaggccagagaaaggattatgaaacagaaaccagtcgagcaaccaaattca
ttaaggcccctaccgtcggagactaaatgtggaccattgatgaaccaaaacaagaatgtg
atcaatgtggaatcaggttcaacaccacttatttccgaagggagggttccagtgtcactt
ggaagcctctcaagtccaagaaggcgtttttctggctcccaaagcatgttttctggctac
ataccttcgccaaagaataaatacagtagcagttttgatttgaagttgacagaagtttcc
agggagctcgaaacctatatttcgaggcaggttttgtgttctgtaatgaaaaaagatgcc
caagaggcttccccaaaataa

DBGET integrated database retrieval system