KEGG   Populus trichocarpa (black cottonwood): 7481536Help
Entry
7481536           CDS       T01077                                 

Definition
(RefSeq) probable serine/threonine-protein kinase PBL9
Organism
pop  Populus trichocarpa (black cottonwood)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr HRCT1 Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 7481536
NCBI-ProteinID: XP_024464238
Position
9
AA seq 376 aa AA seqDB search
MGICLSAQIKAESSCSTGLSSKNASTYGTDLSSTSSKVSSLSVPPTPRSEGEILQSSNLK
SFSFSDLKMATRNFRPDSVLGEGGFGSVFKGWIDEQTFAAAKPGTGMVIAVKRLNQDGFQ
GHKEWLAEVNYLGQLYNPHLFRRGSYFQPLSWNLRMKVSLGAAKGLAFLHSAETKVIYRD
FKTSNILLDSKYNAKLSDFGLAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTAKSDV
YSFGVVLLEMLSGRRAVDKNRPSGEHNLVEWAKPYLANKRKIFRILDSRLEGQYSMDVAY
KVSTLALRCLSIETKFRPTMDEVVTALEQLQDSKETGTANGHVGNKPRIRRRSANDATGG
GSIAAYPRPSASPLYA
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggggatttgcttgagtgcccaaattaaagctgagagctcatgcagcacagggttgagt
tcaaagaatgctagcacatatgggactgatctgagcagtacgagtagcaaggtctcatct
ctttcagtgccacccactcctcggagtgagggtgagatcttgcaatcctctaatctgaag
agcttcagtttttctgatctcaagatggccaccaggaatttccgtcctgatagtgtccta
ggagaaggtggttttggttccgtttttaagggatggattgatgagcaaacatttgctgct
gccaagcctggaactggaatggttattgcggtgaaaaggcttaaccaagatggtttccaa
ggtcacaaggagtggctggcggaagtaaattatctggggcagctctataatcctcaccta
tttagaagaggttcttatttccaaccactttcttggaacctccgaatgaaggtttctctt
ggtgctgcaaaggggcttgcatttcttcatagtgctgaaacgaaagtaatatatagggac
ttcaagacttctaacattctgcttgattcgaaatacaatgcaaaactttctgattttggg
ctggccaaagatgggccgactggtgacaagagtcatgtatctaccagggttatggggacc
tatggttatgctgctccagaatatctagctacagggcatctaactgccaagagtgatgtc
tatagcttcggagttgttttgctagaaatgttatctggcaggagagcagttgataaaaat
cgcccatctggagagcacaatcttgtcgaatgggctaaaccctatctagcaaacaaacgc
aagatctttcgcatcctagatagtcgtcttgaaggtcagtattcaatggatgttgcctat
aaggtctctacccttgcgctacgttgcctatccatagaaaccaagtttcgaccaactatg
gatgaggttgtgacagcattggagcagctccaggattccaaagaaactggtactgccaat
ggccatgtgggcaacaagccccgaatacgtagacgaagtgccaatgatgcaactggtgga
gggagtattgctgcatatcctcggccctctgcatccccgctttatgcgtga

DBGET integrated database retrieval system