KEGG   Populus trichocarpa (black cottonwood): 7482627Help
Entry
7482627           CDS       T01077                                 

Definition
(RefSeq) ethanolamine-phosphate cytidylyltransferase
  KO
K00967  ethanolamine-phosphate cytidylyltransferase [EC:2.7.7.14]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
pop00440  Phosphonate and phosphinate metabolism
pop00564  Glycerophospholipid metabolism
pop01100  Metabolic pathways
Module
pop_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:pop00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    7482627
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    7482627
Enzymes [BR:pop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.14  ethanolamine-phosphate cytidylyltransferase
     7482627
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like Oxidored_molyb
Motif
Other DBs
NCBI-GeneID: 7482627
NCBI-ProteinID: XP_002323699
UniProt: B9IGZ5
Position
16
AA seq 427 aa AA seqDB search
MGGGGGGADGGSDIALHPEKVKIVATCLVVAVGVSLLGLYLKSGAEWRSNWSLSLNKKKK
PIRVYMDGCFDMMHYGHCNALRQARALGDQLVVGVVSDDEIIANKGPPVTPVHERMIMVN
AVKWVDEVISDAPYAITEDFMKKLFDEYNIDYIIHGDDPCVLPDGTDAYALAKKAGRYKQ
IKRTEGVSSTDIVGRMLLCTRERSISDSHNQSSLQRQFSHGHSQKFEDGGSGSGTRVSHF
LPTSRRIVQFSNDKGPGQDARIVYIDGAFDLFHAGHVEILKLARALGDFLLVGMHNDHIV
SSKRGAHRPIMNLHERSLSVLACQYVDEVIIGAPWEVSKDMITTFNISSVVHGTVAENND
FLKEKDNPYVVPISMGIFQVLDSPLDITTTTIIKRIVSNHEAYQKRNQKKAASERRYYED
KAYVSGD
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgggtggtggtggaggtggagctgatggtggttcagacattgcactgcatcccgagaag
gtgaagattgtagccacatgtttggtggttgcggttggcgtatccctcttagggttatat
ctcaagtccggcgccgaatggaggtctaattggtcattatctttaaacaagaagaagaag
ccaattcgagtgtacatggacggctgtttcgacatgatgcactacggacactgcaacgcc
ctccgccaagcacgcgccctcggagatcaattggtggtgggcgttgttagcgacgacgaa
attatagccaataaaggtcctccagtgacacctgtccatgaaaggatgattatggtgaat
gcggtgaaatgggtggacgaggtgatttcagatgcgccatacgctataactgaagacttc
atgaagaagctttttgatgaatataatattgattatattattcacggcgatgatccttgc
gtcctccctgatggcaccgatgcttatgcgctcgctaagaaagctggccgttacaaacag
attaagcgcactgaaggcgtttccagcacggatatcgttggtcgcatgcttctgtgtact
cgagagagatccattagtgacagccacaatcagtcgtcattgcaaaggcagtttagccat
gggcacagccagaaatttgaagacggtggatctggaagtggaactcgggtttctcatttc
cttcctacttcacgcagaattgtacaattctccaatgacaaggggccagggcaggatgct
cgcatagtttatattgatggtgcgtttgatctcttccatgctggacatgtcgagattctc
aagcttgctcgagcgcttggagattttcttcttgttggaatgcacaatgatcatatagtc
agttcaaaaagaggtgcacaccgtcctattatgaatcttcatgaaagaagtttaagtgtg
ttggcatgtcaatatgtggatgaggtgattataggtgctccatgggaagtatctaaagac
atgattacaaccttcaacatctcttcagttgtccatgggacagttgcagagaacaatgac
tttctgaaggaaaaagacaatccttatgttgtgccaatcagtatgggtatcttccaagtt
ttggatagccctttagatattacaaccaccacgataattaagaggattgtatcaaatcat
gaagcatatcagaaacgtaatcagaagaaggcagcaagtgagaggaggtattatgaggat
aaagcttatgtatctggtgattga

DBGET integrated database retrieval system