KEGG   Populus trichocarpa (black cottonwood): 7482801Help
Entry
7482801           CDS       T01077                                 

Definition
(RefSeq) photosynthetic NDH subunit of lumenal location 5, chloroplastic
  KO
K03768  peptidyl-prolyl cis-trans isomerase B (cyclophilin B) [EC:5.2.1.8]
Organism
pop  Populus trichocarpa (black cottonwood)
Brite
KEGG Orthology (KO) [BR:pop00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pop03110]
    7482801
Enzymes [BR:pop01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     7482801
Chaperones and folding catalysts [BR:pop03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    7482801
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 7482801
NCBI-ProteinID: XP_002299326
UniProt: B9GMP1
Position
1
AA seq 263 aa AA seqDB search
MAASFTTLPNVGSLFSPINTMSRVKSGSSTACNAVKFPSRNLLPSNVSSSSSSLFFSGSL
RFASVTTSSPKKSRVLSSVRASAEVAELQSKVTNKVYFDIGIGNPVGKLVGRIVIGLFGD
DVPQTAENFRALCTGEKGFGFKNSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDEN
FKLSHIGPGVLSMANAGPNTNGSQFFICTVKTPWLDQRHVVFGQVLEGMDIVKLIESQET
DRGDRPTKRVVILESGELPMTEA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcggcttcttttacaactctgccaaatgtgggctcactattcagccccataaatacc
atgtcgcgggtaaaatcaggaagctccaccgcgtgtaatgcagtcaagtttcccagcaga
aatttgttgccgtctaatgtttcctcgtcttcatcgagcttgttcttctcgggttcgctt
cgttttgcttctgttacaacctcgtctccgaagaaatcccgtgttctaagctccgttcga
gctagtgcagaggttgcggagttgcagtcaaaggtgaccaacaaagtgtattttgatata
gggattgggaatccagtagggaagcttgttgggagaattgtcattgggttatttggtgat
gatgtgccacaaacagcagagaacttccgtgcattatgtacaggagagaagggctttggt
ttcaaaaattctgctttccaccgtgtcatcaaagatttcatgattcaaggaggggacttt
gacaaaggaaatggcactggaggtaaaagcatatacggccgcacattcaaagatgaaaac
ttcaagttatcacatattggaccaggagttcttagtatggcaaatgcagggcccaacacc
aatggaagccaattttttatctgcactgttaagactccatggctagatcaaaggcatgtt
gtgtttgggcaagttttggaaggcatggacattgttaaattgatcgagtcacaagagaca
gacagaggagaccgtcccacaaagagagtggtgatccttgaaagtggcgagcttcccatg
accgaggcatga

DBGET integrated database retrieval system