KEGG   Populus trichocarpa (black cottonwood): 7482896Help
Entry
7482896           CDS       T01077                                 

Definition
(RefSeq) putative receptor-like protein kinase At4g00960
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
pop  Populus trichocarpa (black cottonwood)
Brite
KEGG Orthology (KO) [BR:pop00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pop01001]
    7482896
Enzymes [BR:pop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     7482896
Protein kinases [BR:pop01001]
 Serine/threonine kinases: TKL group
  IRAK family
   7482896
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal APH PIP49_C DUF5471
Motif
Other DBs
NCBI-GeneID: 7482896
NCBI-ProteinID: XP_024463235
Position
8
AA seq 394 aa AA seqDB search
MTKPNNFLQNLMKPFKLNSSKEGPEEEDLEKIAEQEQKQFSFETLLSATKDFHPTHKLGE
GGFGPVYKGKLDDGREIAVKKLSHSSNQGKKEFMNEAKLLARVQHRNIVNLLGYCAHGVE
KLLVYEYVANESLDKLLFKSDKRGQLDWKTRYNIIIGIARGLLYLHQDSHSCIIHRDIKA
SNILLDDKWVPKIADFGMARLFPEDQTHVNTRVAGTNGYMAPEYVMHGHLSVGADVFSFG
VLVLELISGQRNSTFSQQHVEAQNLLDWAYKHHKKDRSLEIMDPELASSAVTEEVKTCIH
IGLLCTQGDPQSRPHMRRIVVLLSRKPSNLEEPGRPGVPGSRYRRSRRPGGMSSTAGTFG
TAGTFGESDSRTFNSSSNTKTATASTSASRETPP
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagcccaataatttcttgcagaatctgatgaagcctttcaagctcaactcaagc
aaagagggaccagaagaggaggacttggagaagattgctgaacaggaacagaagcagttt
tcttttgagactttgctctctgctaccaaagatttccacccaactcacaagctcggtgaa
ggtggatttggacctgtatacaaggggaagttggatgatgggagagagattgcagtgaag
aagctgtctcacagttcaaatcaggggaagaaagaattcatgaatgaggcaaagctatta
gcacgagtccagcatcgaaatattgtaaatttgttaggatattgtgcacatggtgtggaa
aagctactggtttacgagtatgttgccaatgagagccttgacaagcttctgttcaaatct
gacaaaagaggacagcttgattggaagacgagatataatataataattggcattgctcgg
ggtttgctttaccttcatcaggattctcacagttgcatcatccaccgtgacatcaaggca
agcaatattttactggatgacaaatgggttcctaagattgctgattttggcatggcccgt
ctgttcccggaagatcaaacacatgtcaacacccgtgttgctggtaccaacgggtatatg
gctccagagtatgtcatgcatggacatttatcggtgggggcagatgtatttagctttggg
gttttggttctggaactgatcagcggccaaagaaattcaacatttagtcaacagcatgtt
gaagcacagaatctacttgattgggcatataagcaccacaagaaagataggagtttggag
attatggacccagaattagcatcctcagcagtcaccgaagaggtgaaaacatgtattcat
atagggctgctatgcacacaaggtgatccacagtcgcggccgcatatgcgacgtattgtt
gtcctgttgtcaaggaaacctagcaatctagaagaaccaggcagacctggagttcctggt
tctagatataggagatctcgaaggccaggaggaatgtcctcaactgctggaacattcggt
actgctggaacattcggtgaatctgattcccgtacatttaattcaagctcaaatactaaa
actgccaccgcgtctacctcagcttcgagagaaacgcccccttga

DBGET integrated database retrieval system