KEGG   Populus trichocarpa (black cottonwood): 7484420Help
Entry
7484420           CDS       T01077                                 

Definition
(RefSeq) probable serine/threonine-protein kinase WNK3 isoform X1
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
pop  Populus trichocarpa (black cottonwood)
Brite
KEGG Orthology (KO) [BR:pop00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pop01001]
    7484420
   01009 Protein phosphatases and associated proteins [BR:pop01009]
    7484420
Enzymes [BR:pop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     7484420
Protein kinases [BR:pop01001]
 Serine/threonine kinases: Other
  Wnk family
   7484420
Protein phosphatases and associated proteins [BR:pop01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     7484420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 7484420
NCBI-ProteinID: XP_002318673
Position
12
AA seq 586 aa AA seqDB search
MPQESSSETDPDDSDAEFVEIDPTGRYGRYKEVLGRGAFKKVYRAFDEFEGIEVAWNQVK
VADLLRNSVDLERLYSEVHLLNTLKHKNIIKFYNSWIDTKNENINFITEIFTSGTLRQYR
QKHKHVGLRALKKWSRQILEGLLYLHSHDPPVIHRDLKCDNIFVNGNQGEVKIGDLGLAA
ILQQARSAHSVIGTPEFMAPELYEEEYNELVDIYAFGMCLLELVTVEYPYVECTNAAQIY
KKVTSGIKPASLAKVKDPAVKAFIEKCTAKVSDRLPAKELLMDPFLQSDEENESVGHSFR
PKAHSSGGSSDQIDVNEIAKDSSAEPIRDFTVQGQRKDINTIFLKLRIADSTGHIRNIHF
PFDVEVDTAIAVASEMVEELDLTDQDVSTIAAMIDSEIRSHIPGWASHNVSPENLVAEDS
EPPFETKDDSSPLSNESIPSPGSLVLERLPSGRKYWSDSPKDVDGNSPSKLGRSNLSCHE
PSLSCPNAARSNGQLEAESMSDDDDNSAKHGSNRSDDLQYANRNSTSVKIIAEKLDKLLV
MQQQELEELKRKHKVAILDLLNEVSPEIRQDVLNICKLKIPVHEMP
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgccacaggaatcctcgtccgagacagacccggatgattctgatgctgagttcgtagag
attgatcccactggtcgttatggtcggtataaagaggtattaggcaggggtgctttcaag
aaagtatatagagcatttgatgaatttgaaggaatagaagtagcttggaatcaagttaaa
gtggcagatctattacgtaattcggtggatttggagcgtttatattctgaagttcatttg
cttaatactttgaagcataaaaacattatcaagttttacaattcgtggatcgataccaaa
aatgagaatatcaacttcatcactgagattttcacttctgggacattgcggcagtatcgg
cagaagcataagcatgtaggtctaagagcattgaagaaatggtctaggcagatcttagag
ggacttttgtatcttcatagtcatgatccaccagttatccacagagatttaaaatgtgac
aacatctttgttaatggaaaccaaggtgaagtgaaaattggtgacttgggtttggctgcc
attcttcagcaagctcggtcagctcatagtgttattggtacaccagagtttatggcacca
gagctttatgaggaggagtataatgagcttgttgacatttatgcctttggcatgtgcctg
ctagagttggtgactgttgaatatccatatgtggaatgcaccaatgctgctcaaatatat
aagaaagtgacatcaggaattaaaccagcatcattagcgaaggtgaaagatcctgctgtg
aaagcatttatagaaaaatgtactgcaaaggtctctgatcgattgccggcaaaggaactt
ttgatggatccctttcttcaatcagatgaggaaaatgaaagtgttggtcactctttccga
ccgaaagcccattcttcaggtggtagttctgatcagattgatgttaatgaaattgctaag
gattcttctgctgaaccaatcagagatttcactgtgcaaggtcagaggaaagacattaat
acaatatttttgaaactaaggatagctgattccacaggtcatatccgcaatatccacttc
ccatttgatgttgaggtcgatacagcaattgcagttgctagtgaaatggtggaggagttg
gatctgactgatcaagatgtttcaacaattgctgctatgattgattcagaaattcggtcc
catattccgggttgggcttcccacaatgtttcaccagaaaatttagttgcagaggactca
gaacctccttttgaaactaaggatgacagttcacctttgtcaaatgaatccattccctct
cctggcagtcttgtattggaaagattgccttcaggtcgtaagtattggtccgactcaccc
aaggacgttgatggaaactctccaagcaagcttggacgttcaaacttgtcttgtcatgag
ccttctctaagttgtccaaatgctgctcggtcaaatggacagttggaggctgagagcatg
tctgatgatgatgataacagtgcaaaacatggaagtaacagatctgatgatttgcaatat
gctaatagaaacagcacatctgtcaagatcattgctgagaaacttgataaacttctagta
atgcagcaacaagagctagaggaactaaagaggaagcacaaagtagccatattagacctt
ctgaatgaagtgtctccagaaattcgtcaggatgttttaaatatatgtaaactgaaaata
cctgttcatgaaatgccgtga

DBGET integrated database retrieval system