KEGG   Populus trichocarpa (black cottonwood): 7489580Help
Entry
7489580           CDS       T01077                                 

Definition
(RefSeq) methionine--tRNA ligase, chloroplastic/mitochondrial
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
pop00450  Selenocompound metabolism
pop00970  Aminoacyl-tRNA biosynthesis
pop01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pop00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    7489580
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    7489580
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pop01007]
    7489580
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pop03016]
    7489580
Enzymes [BR:pop01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     7489580
Amino acid related enzymes [BR:pop01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   7489580
Transfer RNA biogenesis [BR:pop03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    7489580
 Prokaryotic type
   Other AARSs
    7489580
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-GeneID: 7489580
NCBI-ProteinID: XP_002316296
UniProt: B9HTK5
Position
10
AA seq 610 aa AA seqDB search
MAARINYSVQNTLCLLNPLNYSINAKTTHFKTGINFSKNLIFPRKLRRPTFCTCAISNNH
MQSSEAAETFVLTTPLYYVNAPPHMGSAYTTIAADAIARFQRLLGKKVIFVTGTDEHGEK
IAASAAAAGSTPSEHCDVISQAYKTLWKDLEITYDKFIRTTDPKHEGIVKEFYSRVLAKG
DIYRADYEGLYCVNCEEYKDEKELLDNKCCPTHLKPCIERKEDNYFFALSKYQKQLEENL
TQNPKFVQPPFRLNEVQSWIKSGLKDFSISRASVDWGIPVPNDNKQTIYVWFDALLGYIS
ALSAENEQPDLQTAVSSGWPASLHLIGKDILRFHAVYWPAMLMSAGVDLPKKVFGHGFLT
KDGMKMGKSLGNTLEPNELVHNFGSDAVRYFFLREVEFGSDGDYSEERFINIVNAHLANT
IGNLLNRTLGLLKKNCQSTLAVDSAVAAEGNALKDTIEKLVEKARIHYENLSLSSACEAV
LEIGNAGNAYMDENAPWTRFKQGGAASEAAAKDLVIILEAMRIVAIALSPVAPSFCWRIY
EQLGYSKDHFNTVTWSGTKWGGLKGGQVMAQPKPVFARIENKTELEDEAATKKPVKSKQK
KPQAQVAAEA
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atggcagctagaatcaactactctgtacaaaacacactctgtctcctaaaccctttaaac
tattccatcaatgcaaaaacaacccatttcaagaccggtattaatttctctaaaaatctc
atctttcctcgtaaattaaggagacccacgttttgcacttgtgcaataagcaataatcat
atgcaaagtagtgaagcagctgagacttttgtccttacaactccactttattacgttaat
gcacctcctcatatggggagtgcttacaccactattgctgctgatgccattgctcgattt
cagaggcttttaggaaagaaagttatatttgtaactggaacggatgaacacggggagaag
atagctgcttctgctgctgctgctggttccacaccgagtgagcattgtgatgtcatatct
caagcttacaagacactttggaaagatttagagattacttatgataagttcattcggaca
actgatcctaagcatgaaggaatagtaaaggaattttattcgagggttcttgccaagggt
gacatttaccgagctgattatgagggattgtactgtgtcaactgtgaggagtataaggat
gagaaggagctacttgataacaaatgttgtcctacacacctcaagccatgcattgagcgg
aaggaggataattacttctttgccctatcgaagtaccaaaaacaattagaagaaaatttg
acacagaatccgaaatttgtgcagccaccatttcgtttgaatgaggtacaaagttggatc
aaaagtggtttgaaagatttttcaatttctcgtgcatcagtggattggggcattcctgtt
cctaatgacaataagcagactatatatgtttggtttgatgctttacttggctatatatca
gctctatcagcggaaaatgagcaaccagatttacaaactgctgtttcttctggctggccg
gcttcactacatttgattggcaaggacattttacgttttcatgcagtttattggccagct
atgctaatgtctgctggagtagaccttcctaagaaggtctttgggcatggatttttgaca
aaggatggtatgaagatggggaagtcactggggaatacgcttgaaccaaatgagttggtt
cataactttgggtcagatgcggttaggtatttcttccttagagaggtggaatttggtagt
gatggggactattcagaagaacgtttcatcaatattgtcaatgcacatctcgcaaatacc
ataggaaaccttcttaatcgcacacttggacttcttaaaaagaactgccaatcaacgttg
gcggttgattcagctgttgcggctgaaggaaatgcattgaaggacaccattgagaaattg
gttgaaaaggctcgaattcattatgaaaatctctcactatcgtcggcttgcgaggctgta
ctagagattggtaatgccgggaatgcctacatggatgagaatgcaccttggacccgtttc
aagcaagggggtgctgcttctgaagctgctgcaaaggatcttgtaattatattggaagca
atgaggatcgtagcaattgctttatcccctgttgccccaagtttctgttggagaatatat
gaacagcttggctactcgaaggaccattttaacacagtcacctggagcgggacaaagtgg
ggtggcctgaagggtggtcaggtcatggctcaacctaaaccagtttttgcaaggattgag
aataaaacagaactggaagacgaagcagcaactaagaagcctgtgaaaagcaagcagaaa
aaacctcaggctcaagtagctgcagaagcttag

DBGET integrated database retrieval system