KEGG   Populus trichocarpa (black cottonwood): 7491044Help
Entry
7491044           CDS       T01077                                 

Definition
(RefSeq) tubulin alpha-3 chain
  KO
K07374  tubulin alpha
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
pop04145  Phagosome
Brite
KEGG Orthology (KO) [BR:pop00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    7491044
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pop03019]
    7491044
   03036 Chromosome and associated proteins [BR:pop03036]
    7491044
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pop04812]
    7491044
   04147 Exosome [BR:pop04147]
    7491044
Messenger RNA biogenesis [BR:pop03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     7491044
Chromosome and associated proteins [BR:pop03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     7491044
Cytoskeleton proteins [BR:pop04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    7491044
Exosome [BR:pop04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   7491044
  Exosomal proteins of other body fluids (saliva and urine)
   7491044
  Exosomal proteins of colorectal cancer cells
   7491044
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tubulin Tubulin_C Tubulin_3
Motif
Other DBs
NCBI-GeneID: 7491044
NCBI-ProteinID: XP_002325422
UniProt: B9IPR1
Position
19
AA seq 449 aa AA seqDB search
MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGTMPSDTSIGAEHDSFNTFFSETGSGK
HVPRAIFVDLEPSVIDEVRSGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLD
RVRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA
VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQIISSLTT
SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQISVPEITSAVFEPSS
MMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVSTIKTKRTVQFVDWCPTGFKCGINYQPP
TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE
AREDLAALEKDYEEVGAEGGDDEGEDEDY
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgagggagataataagcatacatattggacaagcagggattcaggttgggaattcttgt
tgggaactttattgtcttgaacatggaatacagcctgatggaacgatgcctagtgacacc
tcaatcggagcggaacatgattcttttaataccttcttcagcgaaactggttcaggaaag
catgtgccgagagctatatttgttgatctcgaaccctctgtcattgatgaagtcagaagt
gggacttacagacagctttttcaccctgaacaacttatttctggcaaggaagacgctgct
aataactttgccaggggacattatacagtgggaagggaaattgttgatctatgcctggac
cgcgtgaggaaattggcagacaattgcactggtttgcaagggtttttggtatttagtgct
gttggtggtggcactggttctggtttgggctcgctgcttttggaacgattgtctgtggat
tatggaaagaagtcaaaacttggcttcaccatctatccttctcctcaggtttctactgct
gtcgtggaaccttacaacagtgttctctccactcactctctccttgaacacacagatgtt
gctgtgcttttggacaatgaagctatttatgacatctgcaggagatctttagacattgaa
agaccaacatacaccaatttgaaccgtttgatttcccaaattatctcatctttgacaact
tccttgaggtttgatggggccattaatgtggacatcacagagtttcaaactaatctcgtt
ccatatcctcgcatccatttcatgctttcatcttatgctccagtaatctcagctgccaag
gcttaccatgagcagatttcagttcctgagatcacaagtgctgtgtttgaaccctcaagt
atgatggctaaatgtgatccaaggcatggaaaatacatggcttgctgtctcatgtatcgt
ggagatgttgtaccaaaggatgttaattctgccgtttccaccattaagacaaagaggaca
gttcaatttgttgactggtgcccaactggtttcaagtgcggtataaactaccaaccacca
acagtggtacctggaggtgatcttgctaaagtgcagcgtgcagtttgcatgataagcaac
aacacagcagtagctgaggtcttctccagaattgaccacaagtttgatctcatgtactct
aagcgagcatttgtccactggtatgtgggcgaaggcatggaggaaggtgaattctcagaa
gctcgtgaagatcttgctgcccttgagaaagactacgaggaagtcggagcagaaggtggt
gatgacgagggtgaggacgaagattactga

DBGET integrated database retrieval system