KEGG   Populus trichocarpa (black cottonwood): 7494250Help
Entry
7494250           CDS       T01077                                 

Definition
(RefSeq) myb-related protein 308
  KO
K09422  transcription factor MYB, plant
Organism
pop  Populus trichocarpa (black cottonwood)
Brite
KEGG Orthology (KO) [BR:pop00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pop03000]
    7494250
Transcription factors [BR:pop03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Myb, Myb-factors
    7494250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myb_DNA-binding Myb_DNA-bind_6 SLIDE AAA_9 Myb_DNA-bind_7 Rap1_C
Motif
Other DBs
NCBI-GeneID: 7494250
NCBI-ProteinID: XP_002312966
UniProt: B9HR69
Position
9
AA seq 271 aa AA seqDB search
MGRSPCCEKAHTNKGAWTKEEDDRLVAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY
LRPDLKRGNFTEAEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG
IDPATHRPLNEPAVQEATTTISFTTTTTSVLEEESLGSIIKEENKEKIISATAFVCKEEK
TQVQERCPDLNLELGISLPSQNQPDHHQPFKTGGSRSLCFACSLGLQNSKDCSCNVIVST
VGSSGSTSTKTGYDFLGMKSGVLDYRSLEMK
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgggaaggtctccttgctgtgaaaaagcccatacaaacaagggtgcgtggaccaaggag
gaagacgatcgccttgttgcttacattagagctcacggtgaaggttgctggcgctcactt
cctaaagccgctggccttcttagatgtggcaagagttgcagacttcgttggatcaactat
ttaagacctgaccttaaacgtggcaatttcaccgaagcagaagatgagctcattatcaaa
ctccatagcctccttggaaacaaatggtcactcatagctggaagattaccagggagaaca
gataatgagataaagaattattggaacacacatataagaaggaagcttttgaacagaggc
atagatcccgcaactcataggccactcaacgaaccagcagtacaagaagccacaacaaca
atatctttcaccacgactactacttcagtacttgaagaagagtctctgggttctataatt
aaagaggaaaataaagagaagataattagcgcaactgctttcgtatgcaaagaagagaaa
acccaagttcaagaaaggtgtccagacttgaatctcgagcttggaattagccttccttcc
caaaaccagcctgatcatcaccagccattcaaaactggaggaagtagaagtctttgtttt
gcttgcagtttggggctacaaaacagcaaggattgcagctgcaatgttattgtgagcact
gttgggagcagtggcagcactagcacaaagactggttatgacttcttgggcatgaaaagt
ggtgttttggattatagaagtttagagatgaaataa

DBGET integrated database retrieval system