KEGG   Populus trichocarpa (black cottonwood): 7494326Help
Entry
7494326           CDS       T01077                                 

Definition
(RefSeq) equilibrative nucleotide transporter 3
  KO
K15014  solute carrier family 29 (equilibrative nucleoside transporter), member 1/2/3
Organism
pop  Populus trichocarpa (black cottonwood)
Brite
KEGG Orthology (KO) [BR:pop00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pop02000]
    7494326
Transporters [BR:pop02000]
 Solute Carrier Family (SLC)
  SLC29: Facilitative nucleoside transporter
   7494326
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nucleoside_tran SLATT_5 MFS_1
Motif
Other DBs
NCBI-GeneID: 7494326
NCBI-ProteinID: XP_002304989
UniProt: B9H201
Position
4
AA seq 411 aa AA seqDB search
MEGSSQSEAPRRLEGKYLGMACCWALGLATLVAWNCMLTIEDYYYKLFPKYHPARLLTLI
YMPFAVVSMAILTYYESKIDTRKRNLSGLVLFFLSSLLLLLLDLASSGKGGIGNFIGIGA
IAGSFGVADALLQGGMVGDLFFMCPEFLQSYLAGIAASGFLISALRLLTKAAFEKFPNGL
RKGVILFLVISIFFEFQCILVYAFLFPKLPIVKYYRLKASTEGSNTVSADLAAGGIHINQ
EDENEAKRHERLSNKELFFENIDYAVDLILIFVLTLSIVPGFIYEDTGSHQLHSWYALVL
ITMYNACDLISRYIPLVEFLKLKSRKGLMIAVLSRFLLIPAFYFTAKYSDQGWMILLISF
LGLTNGYLTVCVITEAPKGYKGPEQNALGNLLVLCVLCGVFAGVALDWLWL
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggaaggttccagtcaaagtgaggctccaagaagactcgagggaaagtatttagggatg
gcatgttgttgggctcttggacttgcaacacttgtcgcatggaactgcatgctgacaatc
gaagattactactataaattgttcccgaaataccatcctgcaaggctgctcactctcatt
tacatgccatttgctgttgtatctatggctatactgacatattatgagtccaagatcgat
actcgaaagcgcaacctatctggcctcgtacttttctttttgagttcgttgttgcttcta
cttttggatttagcttcatcaggtaaaggtggaattggaaatttcattggtataggtgca
attgcaggttctttcggagttgcagatgccctccttcaaggtgggatggttggagaccta
ttttttatgtgccctgaattccttcagtcctaccttgctggtatagctgcatcaggtttt
ctaatctctgctctgagactactaacaaaagcagcatttgaaaaattccctaatggtctt
cgcaaaggagttatcctatttttagtgatctccattttctttgagtttcaatgcattctg
gtatatgcatttctcttccccaaactgccaatagtgaagtactaccgcctgaaggcatcc
actgaaggatcaaacactgtctcagctgaccttgcagctggtggcatacacataaaccaa
gaggatgaaaatgaagcgaaacgccatgagaggttgagcaacaaggaattattctttgag
aacatagactatgcagttgacctaattcttatatttgtgctgacattatcaatagttcct
ggctttatatatgaagatactggatcacaccagttacattcatggtatgcacttgttctg
attacaatgtacaatgcatgcgatctgatatcaagatacattcctcttgtggaattcctg
aagctgaagtccagaaagggccttatgatcgcagtactctctcgttttcttctcattcca
gcattttacttcacggcaaagtacagtgatcagggatggatgatcctcctaatttccttc
ttgggattaaccaatggctatctcacagtctgtgttattacagaagcacccaaaggttac
aagggacctgaacaaaatgccttgggtaatttgctggtgctatgtgtattatgtggtgtt
tttgcaggggtagcccttgattggttgtggctttag

DBGET integrated database retrieval system