KEGG   Populus trichocarpa (black cottonwood): 7497404Help
Entry
7497404           CDS       T01077                                 

Definition
(RefSeq) external alternative NAD(P)H-ubiquinone oxidoreductase B4, mitochondrial
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
pop  Populus trichocarpa (black cottonwood)
Brite
KEGG Orthology (KO) [BR:pop00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    7497404
Enzymes [BR:pop01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     7497404
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox EF-hand_1 NAD_binding_8 DAO EF-hand_6 EF-hand_7 NAD_binding_7 DUF5339 p25-alpha
Motif
Other DBs
NCBI-GeneID: 7497404
NCBI-ProteinID: XP_002319927
Position
13
AA seq 579 aa AA seqDB search
MRGSAFFQRAFRTFQEHPTFFKLLIVSTVSGGGLLTFSDASPFQGLITDSSQNEGKKKKV
VVLGTGWAGTSFLKNLKSSSYDVQVVSPNNFFTFTPLLPSVTNGTVEARSIVEPIRNIVK
KKPYNVEFKEAECYKIDPVNKKVYCRSNQSSTLDGIEEFTVDYDVLILAMGARVNTFNTP
GVEEHAHFLKEVGDAQRLRKSIIDCYERASLPSVSEEEKKRVMHFVVVGGGPTGVEYAAE
LHDLAFDDMAKLYPSAKDYLKITLLEAGDHILNMFDKRITTFATEKFQRDGIDVKTGSMV
VKVSDKDISTKERKTGEIVSVPYGVVLWSTGIATRPVVRDFMNHIDQAKRRVLATDEWLR
VEGCEDVYALGDCATINQRKVMEDIAAIFRKADKTNTGTLDLKDFKEVVGHICERYPQVE
LYLQKNKLKSFDALLKNAQGDDKKQIDIEIFKKALSEVDSQMKSLPPTAQVAAQQGEYLA
KCFNRKELCEKNPEGPLRFRASGRHQFHPFRYRHFGQFAPLGGEQTAAQLPGDWVSIGHS
AQWLWYSVYASKLVSWRTRMLVISDWSRKFIFGRDSSKI
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgagagggtctgcattcttccagagagcctttagaacttttcaagagcaccctactttc
tttaagctgcttattgtctccaccgtcagtggtggaggtctgttaacgttttctgatgcc
agtccattccaaggattgatcacagactcatctcagaatgaaggcaagaaaaagaaggtg
gtagttcttggaactggttgggcaggcacaagttttttgaaaaacctgaagagctcttcc
tatgatgttcaagtcgtttctccgaataacttcttcacgttcactcctttgttaccgagt
gtaactaatggaacggtggaagctcgcagcatagtagagccaattcgcaatattgtgaaa
aagaaaccttacaatgttgagttcaaggaagctgaatgttataagattgatccagtaaat
aagaaagtttattgtcgttctaaccaatcctcaactttggatggaattgaagaattcaca
gttgattatgatgtcttgatattggccatgggagctcgtgtaaatactttcaacaccccc
ggtgtcgaggagcatgctcatttcctgaaggaagttggagacgcgcagaggcttcgtaag
tcaataattgactgttacgagcgtgcaagccttccgagtgtaagcgaagaagaaaagaag
cgggtgatgcattttgtagttgttggaggtggtccaacaggtgtggagtatgcagcagag
ctacacgacttggcatttgatgatatggcaaagctatatccctcagctaaagactacctg
aaaataacccttcttgaggctggtgatcacattttgaacatgtttgacaaacgaattact
acatttgctaccgagaaattccaaagagatggcattgatgtaaagacaggatcaatggtt
gtaaaagtgtctgataaggatatttctactaaggagagaaaaaccggtgaaattgtttct
gtaccatacggagtggtcctctggtcaaccggcattgctactcgtcctgttgtcagggat
ttcatgaaccacattgatcaggccaaaaggcgtgttctggcaaccgatgaatggctgagg
gttgaaggctgcgaagatgtatatgctctaggtgactgtgcgactataaatcaacgcaaa
gtcatggaagatatagcagcaatattcaggaaggcagacaagaccaacactggtactcta
gatcttaaagacttcaaagaagttgttggccacatctgtgagagataccctcaagttgag
ctttacttgcaaaagaacaaactgaaaagctttgatgctttactgaagaatgctcaagga
gatgacaagaaacaaatagatatcgaaatatttaagaaggctctatccgaagttgattct
caaatgaaaagtctcccaccaactgctcaggtggctgcacaacaaggagaataccttgca
aaatgtttcaacagaaaggagctttgtgaaaagaatcctgagggtccactgaggttcagg
gcttcaggccgacaccagtttcatcccttcaggtacaggcactttggacaatttgctcca
ttgggtggagagcagactgcagctcaacttccaggagattgggtttcgatcggacatagc
gctcagtggctctggtactcagtttatgcaagcaagctagttagctggcgtacaagaatg
ttggtgatatctgactggtcgagaaagtttatatttggaagggactccagcaaaatctga

DBGET integrated database retrieval system