KEGG   Pseudomonas oryzihabitans: APT59_05915Help
Entry
APT59_05915       CDS       T04267                                 

Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
por  Pseudomonas oryzihabitans
Pathway
por00970  Aminoacyl-tRNA biosynthesis
por01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:por00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    APT59_05915
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:por03029]
    APT59_05915
Enzymes [BR:por01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     APT59_05915
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     APT59_05915
Mitochondrial biogenesis [BR:por03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    APT59_05915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ALZ83765
UniProt: A0A0U4W779
Position
complement(1321977..1323428)
Genome map
AA seq 483 aa AA seqDB search
MHQLTLTEIAAALAAKDFSAEELTGELLQRIEQLDPQLNSFITVTAEQALEQARAADARR
AAGETGALLGAPLAHKDLFCTQGVLTSCGSKILTGFKAPYDATVVERLAAAGTVSLGKLN
MDEFAMGSANESSHYGPVKNPWDVTRVPGGSSGGSAAAVAARLLPAATGTDTGGSIRQPA
ALTNLTGIKPTYGRVSRWGMIAYASSLDQGGPLARTAEDCALLLQAMAGFDPKDSTSVDQ
PVDDYRAALQQPLTGLRIGLPREYFGAGLDARIGEKVLAVVEELKKLGATVKDISLPNLQ
HAIPAYYVIAPAEASSNLSRFDGVRFGYRCENPVNLEDLYKRSRGEGFGAEVKRRIMVGT
YALSAGYYDAYYLKAQRIRRLIKNDFVAAFAEVDVILGPTTPNLAWKLGEKGGDPVSAYL
EDIYTITANLAGIPGLSMPAGFVDGLPVGVQLLGNYFQEGRLLNVAHQYQQVSDWHRQAP
SGF
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgcatcagctgaccctgaccgagatcgccgccgccctggccgcgaaggatttttctgcc
gaagaactgaccggcgagctgctgcagcggatcgagcagctcgatccccagctcaacagt
ttcatcaccgtgaccgccgagcaggccctggaacaggcgcgcgctgccgatgcccgccgc
gccgccggcgagacgggcgccctgctgggcgcgcccctcgcccacaaggacctgttctgc
acccagggcgtgctgaccagctgcggctcgaagatcctcactggcttcaaggcaccctac
gacgccaccgtggtggagaggctggccgcggccggcaccgtctccctcggcaagctgaac
atggacgaattcgccatgggttcggccaacgaatccagccactacggcccggtgaagaat
ccctgggacgtcacccgggtgcctggcggctcttccggcggctccgccgctgccgtggcc
gcgcggctgttgccggctgccaccggcaccgacaccggcggctcgatccgccagccggcg
gccctgactaacctcaccggcatcaagcctacctatggccgtgtctcgcgctggggcatg
atcgcctacgcctccagcctcgaccagggcggtccgctggcacgcaccgccgaggactgc
gccctgctcttgcaggccatggccggcttcgaccccaaggattccaccagcgtcgatcag
ccggtggacgactaccgtgccgccctgcagcagccgctgaccggcctgcgcatcggcctg
ccaagggaatacttcggcgccggtctcgatgcccgcatcggtgagaaggtactggccgtg
gtcgaggagctgaagaagctcggcgccaccgtcaaggacatctccctgcccaacctgcag
cacgccatcccggcctactacgtcatcgccccggccgaggccagctccaacctgtcgcgc
ttcgacggcgtgcgcttcggctatcgctgcgaaaatccggtcaacctggaagatctctac
aagagatcccgcggcgaaggcttcggcgccgaggtgaagcgccgcatcatggtcggcacc
tacgccctgtcggctggctactacgacgcctattacctcaaggcgcagcgcatccgccgg
ctgatcaagaacgactttgtcgcggccttcgccgaggtcgacgtcatcctcggcccgacc
acgccgaacctggcctggaagctcggcgaaaagggtggtgacccggtctccgcctatctc
gaagacatctacaccatcaccgccaacctcgccggcatccccggcctgtcgatgccggcc
ggcttcgtcgatggcctgccggtgggcgtgcaactgctcggcaactatttccaggaaggc
cgtctactcaacgtcgcccaccagtaccagcaggtcagcgactggcatcgccaggcgccg
agcggcttctga

DBGET integrated database retrieval system