KEGG   Pseudomonas oryzihabitans: APT59_08975Help
Entry
APT59_08975       CDS       T04267                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
por  Pseudomonas oryzihabitans
Pathway
por00071  Fatty acid degradation
por00072  Synthesis and degradation of ketone bodies
por00280  Valine, leucine and isoleucine degradation
por00310  Lysine degradation
por00362  Benzoate degradation
por00380  Tryptophan metabolism
por00620  Pyruvate metabolism
por00630  Glyoxylate and dicarboxylate metabolism
por00640  Propanoate metabolism
por00650  Butanoate metabolism
por00900  Terpenoid backbone biosynthesis
por01100  Metabolic pathways
por01110  Biosynthesis of secondary metabolites
por01120  Microbial metabolism in diverse environments
por01130  Biosynthesis of antibiotics
por01200  Carbon metabolism
por01212  Fatty acid metabolism
por02020  Two-component system
Brite
KEGG Orthology (KO) [BR:por00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    APT59_08975
   00630 Glyoxylate and dicarboxylate metabolism
    APT59_08975
   00640 Propanoate metabolism
    APT59_08975
   00650 Butanoate metabolism
    APT59_08975
  09103 Lipid metabolism
   00071 Fatty acid degradation
    APT59_08975
   00072 Synthesis and degradation of ketone bodies
    APT59_08975
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    APT59_08975
   00310 Lysine degradation
    APT59_08975
   00380 Tryptophan metabolism
    APT59_08975
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    APT59_08975
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    APT59_08975
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    APT59_08975
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:por04147]
    APT59_08975
Enzymes [BR:por01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     APT59_08975
Exosome [BR:por04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   APT59_08975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ALZ84330
UniProt: A0A0U4HER0
Position
1964316..1965500
Genome map
AA seq 394 aa AA seqDB search
MNDPIVIVAAARTPMGALGGELAALSAPQLGSAVVRAVLERAGWSPERVDEVLLGCVLPA
GLGQAPARQAALGAGLAQTTRCTTLNKMCGSGMQATILGHDLLRAGSAEVVVAGGMESMS
RAPYLLEKARSGYRLGHGALIDSMFLDGLEDAYEPGRLMGTFAEDCAARLGIGRERQDAY
AQQSLARARQAQASGAFAAEIVPVEVVTRKEILRLDTDEQPRRADPARIPTLKPAFREGG
TVTAANASSISDGAAALLLMRASTAAHEGLTPLATIRGHAAHAGVPGDFPTAPIGAIRTL
LERIDWQLGDVDLFEINEAFAVVALAAQDALGLDPERLNVHGGACALGHPIGASGARILV
TLIQALRHRGLRRGVAAICIGGGEATALALELNN
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaccccattgtcatcgtcgccgctgcccgtacgccaatgggcgccctggggggc
gagctggccgcgctgtcggcgccgcaattgggcagtgccgtggtgcgcgcggtactggag
cgggccggctggtcgcccgagcgagtcgacgaggtgctgctgggctgcgtcctccccgcg
ggccttggccaggcccccgcgcgccaggccgccctcggtgctggcctggcccagacgacg
cgctgtaccaccctgaacaagatgtgcggctcgggcatgcaggcgaccatcctcggtcat
gacctgttgcgtgccggcagtgccgaggtggtggtggcaggtggcatggaaagcatgagc
cgtgcgccttatctgctggaaaaggcccgcagcggctaccgcctcggccatggcgccctg
atcgacagcatgtttctcgacggcctggaagacgcctatgaacccgggcgcctgatgggg
accttcgccgaggattgcgcggcgcgcctgggcatcggccgcgaacgccaggatgcctat
gctcagcagtctctcgcacgggcacgccaggcccaggccagtggcgcctttgccgccgag
atcgtcccggtggaggtagtgacgcgcaaggagatcctgcgcctcgacaccgacgagcaa
ccccgccgcgccgaccctgcgcggattcccacgctcaagccggccttccgcgaaggcggc
accgtgaccgcggccaatgccagctccatctccgatggcgcagcggcgctgctgctgatg
cgcgccagcacggccgcgcatgaaggcctgacgccgctggcgaccatccgtggccacgcc
gcccatgccggggtgccgggcgactttcccaccgcccccatcggcgccatccgcacgctg
ctcgagcgcatcgactggcagttgggtgatgtcgacctcttcgagatcaacgaagccttc
gccgtggtggcgctggctgcccaggatgccctggggctggacccggagcggctgaacgtg
cacggtggtgcctgtgccctgggccaccccatcggtgcctccggcgcgcgcatcctggtg
accctgatccaggcgctgcgccaccgtggcttgcgccggggcgtggccgccatttgcatc
ggcggcggcgaggccaccgcgttggcgctggaactcaacaactag

DBGET integrated database retrieval system