KEGG   Pseudomonas oryzihabitans: APT59_12145Help
Entry
APT59_12145       CDS       T04267                                 

Definition
(GenBank) zinc-binding dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
por  Pseudomonas oryzihabitans
Pathway
por00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:por00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    APT59_12145
Enzymes [BR:por01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     APT59_12145
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     APT59_12145
    1.1.1.-  
     APT59_12145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc TrkA_N
Motif
Other DBs
NCBI-ProteinID: ALZ84904
UniProt: A0A0U4W0K5
Position
2618165..2619229
Genome map
AA seq 354 aa AA seqDB search
MKAARFHAARDIRVEDVPAPGAPGPTQVLVKNQFCGICGTDLHEYLGGPIFIPTAPHSYT
GGKVPQILGHEYSGVVEAVGSQVTSVKPGDRVSIQPMVSPRDDYYGRRGQYQLSEQLAII
GLSHPWGGMAEYSLVEDYNAIPMPDDLSTEHAALIEPTAVTVYATHRGGVKPGDSVLVAG
AGPIGQLQVMAARAAGATRIFLVDLNDNRLEMAHSLVEGLITLNPGSTDVLREIRARTAG
GVGVDVAFECVGAEAPLGMCLEAVRRQGVVVQVGMQGKPPALDGFTLTYKDVDLRGSWCY
STLMWPQVAALIASGQLPAEKVVTRHIALDDVVEQGFEALLDKAGTQLKILIEL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcccgtttccatgccgcccgcgacatccgggtggaagacgtcccggctccc
ggcgcgccgggccctacccaggtcctggtgaaaaaccagttctgcgggatctgcggtacc
gatctgcacgagtaccttggcgggcccattttcattcccaccgcgccgcacagctacacc
ggcggtaaggtgccgcagatccttggccacgagtattccggcgtggtggaggccgttggc
agtcaggtgacgtcggtgaaacccggtgaccgggtctccatccagcccatggtgtcgcca
cgcgacgactactacggccgccgcggccagtaccagctcagcgagcagctggctatcatt
ggcctgtcccatccctggggcggcatggccgagtactccctggtggaggactacaacgcc
atccccatgccggacgacctcagcaccgagcatgcggcgctgatcgagcccacggcggtg
accgtctatgccacccaccggggcggcgtgaagcccggcgacagcgtgctggtcgccggc
gccgggcccatcggccagctgcaggtcatggccgcccgcgcggccggggctacccggatc
ttcctggtggacctcaacgacaaccgcctggagatggcacacagcctggtggaggggctc
atcaccctgaatcccggtagcaccgatgtgctgcgcgagatccgcgcccggacggcgggg
ggcgtgggggtggatgtggccttcgaatgcgtgggtgccgaggcgccgttgggcatgtgc
ctggaagcggtgcggcgccagggcgtggtggtccaggtggggatgcagggcaagccaccg
gcgctggatggcttcaccctgacctacaaggacgtcgacctgcgcggctcctggtgctac
tccacgctgatgtggccccaggtggcagccctgatcgccagcggccagctaccggccgag
aaggtcgtgacccgccatatcgccctggacgacgtggtggaacaggggttcgaggctttg
ctggacaaggccggcacccagctgaagatcctgatcgagctctag

DBGET integrated database retrieval system